SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1cf7:A | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 5.72e-43 | |
2 | 4yo2:A | 186 | 69 | 0.3881 | 0.1398 | 0.3768 | 9.12e-10 | |
3 | 4yo2:A | 186 | 71 | 0.3582 | 0.1290 | 0.3380 | 5.20e-04 | |
4 | 1cf7:B | 82 | 40 | 0.2836 | 0.2317 | 0.4750 | 0.089 | |
5 | 2rcc:C | 311 | 28 | 0.1791 | 0.0386 | 0.4286 | 0.12 | 2rcc:B |
6 | 7p69:B | 169 | 46 | 0.1940 | 0.0769 | 0.2826 | 0.95 | 7nz1:B, 7p7e:B, 7zc5:B, 7zci:B |
7 | 7awt:B | 141 | 46 | 0.1940 | 0.0922 | 0.2826 | 1.3 | |
8 | 8act:A | 873 | 32 | 0.2090 | 0.0160 | 0.4375 | 4.5 | 8act:B, 9f6c:B, 8qyp:A, 8qyq:A, 8qyq:B, 8qyr:B |
9 | 7d8o:A | 163 | 41 | 0.2239 | 0.0920 | 0.3659 | 4.6 | 7d8o:C, 7d8o:E, 7d8o:G, 7d8o:I, 7d8o:K |
10 | 3r7d:A | 291 | 44 | 0.2090 | 0.0481 | 0.3182 | 6.0 | 3r7d:C, 3r7d:B, 3r7f:A, 3r7f:B, 3r7f:C, 3r7l:A, 3r7l:B, 3r7l:C, 3r7l:D, 3r7l:E, 3r7l:F |
11 | 7tjj:I | 380 | 24 | 0.1493 | 0.0263 | 0.4167 | 6.0 | 7mca:I, 7tjh:I, 7tji:I, 7tjk:I, 5v8f:9, 6wgc:9, 6wgg:9, 6wgi:9 |
12 | 4n8g:A | 325 | 45 | 0.1493 | 0.0308 | 0.2222 | 8.5 | 4n8g:B, 4n8g:C, 4n8g:D |
13 | 2xd0:A | 162 | 41 | 0.2239 | 0.0926 | 0.3659 | 9.4 | 2xd0:E, 2xd0:B, 2xd0:X, 2xd0:Z, 2xd0:Y, 2xdb:A, 2xdd:B, 2xdd:E, 2xdd:A |