SRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKA
The query sequence (length=69) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5kl1:B | 70 | 69 | 1.0000 | 0.9857 | 1.0000 | 1.54e-47 | 5kl8:B |
2 | 3alr:C | 67 | 55 | 0.3913 | 0.4030 | 0.4909 | 2.72e-16 | 3alr:A, 3alr:B, 3alr:D |
3 | 2aus:D | 53 | 42 | 0.1884 | 0.2453 | 0.3095 | 1.7 | 2aus:B, 2ey4:E, 2ey4:F, 3hax:C, 3hay:C, 3hjw:B, 2hvy:C, 3lwo:B, 3lwp:B, 3lwq:B, 3lwr:B, 3lwv:B, 2rfk:B |
4 | 6xzd:BP1 | 712 | 25 | 0.1594 | 0.0154 | 0.4400 | 2.8 | 6xzp:BP1, 6xzq:B, 6xzr:BP1, 6y0c:B |
5 | 4dw1:A | 324 | 56 | 0.2174 | 0.0463 | 0.2679 | 3.5 | 8jv5:A, 8jv5:B, 8jv5:C, 8jv6:A, 8jv6:B, 8jv6:C, 5wzy:A |
6 | 2hr5:A | 170 | 23 | 0.1594 | 0.0647 | 0.4783 | 9.6 | 2hr5:B, 3mps:A, 3mps:B, 3mps:D, 3mps:I, 3mps:F, 3mps:K, 3mps:G, 3mps:H, 1nnq:A, 1nnq:B, 3pwf:A, 3pwf:B, 3pza:A, 3pza:B, 3qvd:A, 3qvd:B, 3qvd:C, 3qvd:D, 3qvd:E, 3qvd:F, 3qvd:G, 3qvd:H |