SQKLPQRSHGPKDFLPDGSAAQAERLRRCREELWQLLAEQRVERLGSLVAAEWRPEEGFVELKSPAGKFWQTMGFSEQGR
QRLHPEEALYLLECGSIHLFHQDLPLSIQEAYQLLLTDHTVTFLQYQVFSHLKRLGYVVRRFQPSLEIIFDVYQADAVAT
FRKNNPGKPYARMCISGFDEPVPDLCSLKRLSYQSGDVPLIFALVDHGDISFYSFRDFTL
The query sequence (length=220) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7uxa:D | 264 | 239 | 0.9955 | 0.8295 | 0.9163 | 2.11e-159 | 7zrz:CP1 |
2 | 8iss:D | 289 | 262 | 0.9955 | 0.7578 | 0.8359 | 8.97e-156 | 8hmy:C, 8hmz:C |
3 | 6gjt:E | 181 | 64 | 0.0955 | 0.1160 | 0.3281 | 0.17 | 6gjt:A, 6gjt:B, 6gjt:C, 6gjt:D, 6gjt:F |
4 | 2et1:A | 201 | 54 | 0.0773 | 0.0846 | 0.3148 | 0.63 | 2et7:A, 2ete:A, 2ete:B, 1fi2:A |
5 | 3d19:A | 264 | 48 | 0.0727 | 0.0606 | 0.3333 | 3.5 | 3d19:B, 3d19:C, 3d19:D, 3d19:E, 3d19:F |
6 | 7zkt:B | 202 | 54 | 0.0864 | 0.0941 | 0.3519 | 4.1 | 7zhc:A, 7zhc:B, 7zkt:A, 7zkt:C, 7zkt:D, 7zkt:E, 7zkt:F, 7zkt:G, 7zkt:H |
7 | 6yu6:B | 446 | 66 | 0.0955 | 0.0471 | 0.3182 | 7.7 | 4us3:A, 4us4:A, 6yu2:A, 6yu2:B, 6yu3:A, 6yu4:A, 6yu5:A, 6yu5:B, 6yu6:A, 6yu7:A |
8 | 3o8o:B | 763 | 19 | 0.0500 | 0.0144 | 0.5789 | 8.6 | 3o8o:D, 3o8o:F, 3o8o:H |
9 | 3va8:A | 427 | 64 | 0.0864 | 0.0445 | 0.2969 | 9.3 |