SPYSSDTTSCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLSMS
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6fgp:B | 68 | 68 | 1.0000 | 1.0000 | 1.0000 | 7.03e-47 | 1b3a:B, 1b3a:A, 5coy:A, 5dnf:C, 5dnf:D, 5dnf:I, 5dnf:A, 5dnf:F, 5dnf:G, 5dnf:H, 1u4l:A, 1u4m:A |
2 | 7f1t:A | 423 | 66 | 0.4559 | 0.0733 | 0.4697 | 6.94e-19 | 6akx:A, 6akx:B, 6aky:A, 5d65:B, 5d65:A, 5d65:D, 4mbs:A, 4mbs:B, 5uiw:A |
3 | 2ra4:B | 65 | 59 | 0.2794 | 0.2923 | 0.3220 | 5.79e-12 | |
4 | 2mpm:A | 74 | 61 | 0.3529 | 0.3243 | 0.3934 | 3.27e-11 | |
5 | 4r8i:A | 68 | 60 | 0.2794 | 0.2794 | 0.3167 | 1.60e-07 | |
6 | 2hci:A | 68 | 60 | 0.2941 | 0.2941 | 0.3333 | 2.29e-05 | |
7 | 2nwg:A | 68 | 45 | 0.2206 | 0.2206 | 0.3333 | 6.31e-04 | 2nwg:B, 4uai:A |
8 | 6gwi:B | 450 | 41 | 0.2059 | 0.0311 | 0.3415 | 0.15 | 6gwi:A |
9 | 1ilp:A | 71 | 57 | 0.2059 | 0.1972 | 0.2456 | 0.17 | 1ilq:A, 6xmn:A |
10 | 3hwo:A | 379 | 18 | 0.1618 | 0.0290 | 0.6111 | 4.0 | 3hwo:B, 5jxz:A, 5jxz:B, 5jy4:A, 5jy4:B, 5jy8:A, 5jy8:B, 5jzd:A, 5jzd:B |
11 | 6q2m:A | 544 | 22 | 0.1618 | 0.0202 | 0.5000 | 4.5 | 1ba3:A, 5dwv:A, 4e5d:A, 4g36:A, 4g36:B, 4g37:A, 4g37:B, 5gyz:A, 5gz2:A, 6hps:A, 6hps:B, 3ies:A, 5kyt:A, 5kyt:B, 5kyv:A, 5kyv:B, 6q2m:B, 6q2m:C, 3rix:A, 5wys:A |
12 | 4v6w:Ac | 62 | 23 | 0.1176 | 0.1290 | 0.3478 | 6.0 | 6xu6:Ac, 6xu7:Ac, 6xu8:Ac |
13 | 3e78:A | 365 | 36 | 0.1618 | 0.0301 | 0.3056 | 7.5 | 3e79:A, 3eki:A |
14 | 7t80:A | 216 | 32 | 0.1765 | 0.0556 | 0.3750 | 9.3 | 7t80:B |
15 | 6edk:A | 193 | 18 | 0.0882 | 0.0311 | 0.3333 | 9.3 | 6ci4:A, 6ci5:A |
16 | 5mr0:D | 290 | 32 | 0.1618 | 0.0379 | 0.3438 | 9.7 | 5mr0:A, 5mr0:B, 5mr0:C, 5mr0:E, 5mr0:F |