SPWPVWSGYALCFVPLAAVILGFIIAARFTDKQATSAYLRLDPAKAN
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8iug:h | 47 | 47 | 1.0000 | 1.0000 | 1.0000 | 3.21e-29 | 8iun:h |
| 2 | 6nbq:K | 212 | 18 | 0.1915 | 0.0425 | 0.5000 | 3.4 | 6hum:K, 6khi:K, 6khj:K, 6l7o:K, 6l7p:K, 6nbx:K, 6nby:K, 6tjv:K |
| 3 | 3ayx:A | 595 | 39 | 0.2340 | 0.0185 | 0.2821 | 3.5 | 3ayx:C, 3ayz:A, 3ayz:C, 5y34:A, 5y34:C |
| 4 | 8sr8:A | 1353 | 23 | 0.2553 | 0.0089 | 0.5217 | 5.5 | 8sr8:B, 8sr8:C, 8sr8:D, 8sr9:A, 8sr9:B, 8sr9:C, 8sr9:D, 8sra:A, 8sra:B, 8sra:C, 8sra:D, 8srb:A, 8srb:B, 8srb:C, 8srb:D |
| 5 | 8sre:A | 1377 | 23 | 0.2553 | 0.0087 | 0.5217 | 5.6 | 8sr7:A, 8sr7:B, 8sr7:C, 8sr7:D, 8src:A, 8src:B, 8src:C, 8src:D, 8srd:A, 8srd:B, 8srd:C, 8srd:D, 8sre:B, 8sre:D, 8sre:C, 8srf:A, 8srf:B, 8srf:C, 8srf:D, 8srg:A, 8srg:B, 8srg:C, 8srg:D, 8srh:A, 8srh:B, 8srh:C, 8srh:D, 8sri:A, 8sri:B, 8sri:C, 8sri:D, 8srj:A, 8srj:B, 8srj:D, 8srj:C, 8srk:A, 8srk:B, 8srk:C, 8srk:D |
| 6 | 3jb9:A | 1964 | 33 | 0.2340 | 0.0056 | 0.3333 | 5.7 | |
| 7 | 7d6v:C | 264 | 35 | 0.2766 | 0.0492 | 0.3714 | 5.9 | 7d6x:C |
| 8 | 7dge:A | 784 | 35 | 0.2553 | 0.0153 | 0.3429 | 7.1 | 1ewk:A, 1ewk:B, 1isr:A, 1iss:A, 1iss:B, 3ks9:A, 3ks9:B |
| 9 | 4or2:B | 366 | 41 | 0.2766 | 0.0355 | 0.3171 | 9.8 | 4or2:A |
| 10 | 1saz:A | 375 | 23 | 0.2340 | 0.0293 | 0.4783 | 9.8 |
umich.edu