Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIWQSAPDIGRKLERLEDLKSKTLGDLVRE
AEKIFNK

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6gza:A 87 87 1.0000 1.0000 1.0000 7.79e-61
2 2r02:A 697 57 0.1839 0.0230 0.2807 0.45 3c3o:A, 3c3q:A, 3c3r:A, 2r03:A, 2r05:A, 5v3r:A, 5wa1:A, 2xs1:A, 2xs8:A
3 2a5v:A 210 33 0.1379 0.0571 0.3636 0.53 2a5v:B, 2a5v:C, 2a5v:D, 1ym3:A
4 8egk:B 355 69 0.2299 0.0563 0.2899 0.70
5 8y6o:X 131 36 0.1379 0.0916 0.3333 0.87
6 1qp8:A 301 26 0.1264 0.0365 0.4231 2.5 1qp8:B
7 7l00:C 315 32 0.1494 0.0413 0.4062 4.3 7l00:A, 7l00:B, 7l00:D
8 7oj1:A 401 53 0.1954 0.0424 0.3208 6.0
9 5tip:A 436 44 0.1609 0.0321 0.3182 6.8 5tip:B, 5tip:C, 5tip:D, 5tiq:A, 5tiq:B
10 1o7a:A 483 41 0.1494 0.0269 0.3171 8.1 2gk1:N, 2gk1:O, 2gk1:P, 2gk1:R, 2gk1:T, 3lmy:A, 3lmy:B, 1now:A, 1now:B, 1np0:D, 1np0:E, 1np0:F, 1o7a:B, 1o7a:C, 1o7a:D, 1o7a:E, 1o7a:F
11 6bdn:A 307 69 0.2184 0.0619 0.2754 8.3
12 4nff:A 229 20 0.1149 0.0437 0.5000 9.1
13 3qum:Q 237 20 0.1149 0.0422 0.5000 9.4 2zck:P
14 7abi:P 237 54 0.1839 0.0675 0.2963 9.8 7aav:P, 7abg:P

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218