Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIY

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 3eyi:B 67 64 1.0000 0.9552 1.0000 6.32e-44 3eyi:A, 4ka4:A, 4ka4:E, 4ka4:B, 4ka4:D
2 4kmf:A 62 56 0.3125 0.3226 0.3571 9.48e-05
3 4wcg:B 61 60 0.2812 0.2951 0.3000 0.063 4wcg:A
4 7zhf:A 250 53 0.2188 0.0560 0.2642 0.99 7zhk:A, 7zhk:B, 7zhk:C
5 5xw2:A 375 22 0.1250 0.0213 0.3636 2.4 4e2p:A
6 3w5j:A 194 57 0.2812 0.0928 0.3158 3.0
7 3zqc:J 119 34 0.1719 0.0924 0.3235 3.4 3zqc:A, 3zqc:D, 3zqc:G
8 2ev9:B 263 27 0.1562 0.0380 0.3704 4.4 2cy0:A, 2d5c:A, 2d5c:B, 2ev9:A
9 1h88:C 152 59 0.2031 0.0855 0.2203 4.9 1h89:C, 1h8a:C, 1mse:C, 1msf:C
10 7ckq:C 1061 23 0.1562 0.0094 0.4348 9.3
11 7f75:C 1133 23 0.1562 0.0088 0.4348 9.5
12 6wvj:C 1117 23 0.1562 0.0090 0.4348 9.8

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417