SPERGRKRLGIYLAHFLDHVEGHMGEIGVQRDALAEDARLGALIDRALADMAVARASLNAVLRDL
The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hk5:B | 66 | 65 | 1.0000 | 0.9848 | 1.0000 | 1.63e-40 | 6hk5:C, 6hk5:E, 6hk5:G, 6hk5:A, 6hk5:D, 6hk5:F, 6hk5:H |
2 | 8unx:A | 244 | 58 | 0.2923 | 0.0779 | 0.3276 | 0.99 | 7f1o:A, 7f1z:A, 7f23:A, 7f24:A, 5g53:C, 8gfv:A, 8gfw:A, 8gfx:A, 8gfy:A, 8gfz:A, 8gg0:A, 8gg1:A, 8gg2:A, 8gg3:A, 8gg4:A, 8gg5:A, 8gg6:A, 8gg7:A, 8gg8:A, 8gw8:A, 8jr9:A, 8unl:A, 8unm:A, 8unn:A, 8uno:A, 8unp:A, 8unq:A, 8unr:A, 8uns:A, 8unt:A, 8unu:A, 8unv:A, 8unw:A, 8uny:A, 8unz:A, 8uo0:A, 7vui:A, 7vuj:A |
3 | 5b16:A | 722 | 56 | 0.2769 | 0.0249 | 0.3214 | 6.3 | |
4 | 6lxe:A | 768 | 56 | 0.2769 | 0.0234 | 0.3214 | 6.7 | |
5 | 6lxd:A | 918 | 56 | 0.2769 | 0.0196 | 0.3214 | 6.7 | 9asm:A, 9asn:A, 9aso:A, 9asp:A, 9asq:A, 6v5b:A, 6v5c:A |
6 | 8p8k:AAA | 276 | 23 | 0.1538 | 0.0362 | 0.4348 | 8.2 | 8p8k:BBB, 8qrt:AAA, 8qrt:BBB, 8qrt:CCC, 8qrt:DDD, 8qs0:AAA, 8qs0:BBB, 8qs0:CCC, 8qs0:DDD |
7 | 6eg8:I | 372 | 56 | 0.2769 | 0.0484 | 0.3214 | 8.8 | 6au6:A, 1azs:C, 1azt:A, 1azt:B, 7bph:A, 8buz:B, 8bv5:B, 3c14:C, 3c15:C, 3c16:C, 1cjk:C, 1cjt:C, 1cju:C, 1cjv:C, 1cs4:C, 1cul:C, 7e5e:A, 7e5e:B, 7e5e:C, 7e5e:D, 6eg8:J, 6eg8:K, 6eg8:L, 3g82:C, 8gge:A, 8ggf:A, 2gvd:C, 2gvz:C, 3maa:C, 7pde:B, 7pdf:B, 6r3q:B, 6r4o:B, 6r4p:B, 1tl7:C, 1u0h:C, 8uo3:A |
8 | 3gaz:A | 331 | 55 | 0.2615 | 0.0514 | 0.3091 | 8.9 | 3gaz:B |
9 | 8uo1:A | 334 | 56 | 0.2769 | 0.0539 | 0.3214 | 9.1 | 8gga:A |
10 | 6pnl:A | 336 | 35 | 0.2000 | 0.0387 | 0.3714 | 9.5 | 6pmh:A |