BioLiP

>protein
SPCFVQEDKYLRLAIISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLR
WARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWFLIGWTSSVCQNLEKQISLIGQGKTS
DHLIFNMCLIDRWDYMTAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAVAVHNELIISAIFHTIRFVLASRLQSDWMLM
LYFAHTHLTVTVTIGLLLIPKFSHSSLDPEDIRDELKKLYAQLEIYKRKKMITNNP

The query sequence (length=296) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7shf:A	296	296	1.0000	1.0000	1.0000	0.0
2	7she:A	541	265	0.8953	0.4898	1.0000	0.0	7she:B, 7shf:B
3	4or2:B	366	247	0.1892	0.1530	0.2267	3.67e-06	4or2:A
4	7dge:A	784	250	0.1858	0.0702	0.2200	1.63e-05	1ewk:A, 1ewk:B, 1isr:A, 1iss:A, 1iss:B, 3ks9:A, 3ks9:B
5	6n51:B	793	267	0.2095	0.0782	0.2322	8.45e-05	6n4x:B, 6n4y:C, 6n50:A, 6n50:B, 6n50:C, 6n51:A, 8t6j:B, 8t6j:A, 8t7h:A, 8t7h:B, 8t8m:B, 8tao:A
6	8tao:B	771	263	0.2027	0.0778	0.2281	2.13e-04	7fd8:A, 7fd8:B, 7fd9:A, 7fd9:B, 3lmk:A, 3lmk:B, 8t8m:A
7	8jd5:2	785	256	0.2027	0.0764	0.2344	0.002	5cni:A, 5cni:B, 5cnj:A, 5cnj:B, 7e9g:R, 7e9g:S, 8jcu:2, 8jcv:2, 8jcw:2, 8jcx:2, 8jcy:2, 8jcz:2, 8jd0:2, 8jd1:2, 8jd2:2, 8jd3:2, 5kzn:A, 5kzq:A, 7mtr:B, 7mtr:A, 7mts:A, 7mts:B, 4xaq:A, 4xaq:B, 4xas:A, 4xas:B
8	7mtq:B	744	245	0.1791	0.0712	0.2163	0.003	8jd4:2
9	8jcu:3	765	252	0.2061	0.0797	0.2421	0.019	6b7h:A, 5cnk:A, 5cnm:A, 8jcv:3, 8jcw:3, 8jcx:3, 8jcy:3, 8jcz:3, 8jd0:3, 8jd1:3, 8jd2:3, 8jd3:3, 3sm9:A, 8tr0:A, 7wih:A, 7wih:B, 4xar:A
10	6ffh:A	414	79	0.0709	0.0507	0.2658	0.031	5cgc:A, 5cgd:A, 6ffi:A, 4oo9:A, 7p2l:A
11	7epe:A	389	67	0.0676	0.0514	0.2985	0.071	7epf:A
12	7epb:A	779	249	0.1824	0.0693	0.2169	0.46	7epb:B, 7mtq:A
13	8jd6:R	774	64	0.0642	0.0245	0.2969	0.91	7e9h:R, 7e9h:S, 8jd4:4, 8jd5:4, 8jd6:S
14	1esm:A	311	40	0.0574	0.0547	0.4250	3.8	1esm:B, 1esm:C, 1esm:D, 1esn:A, 1esn:B, 1esn:C, 1esn:D, 4f7w:A, 4f7w:C, 4f7w:B, 4f7w:D, 4f7w:E, 4f7w:F, 4f7w:G, 4f7w:H, 4gi7:A, 4gi7:C, 4gi7:B, 4gi7:D, 4gi7:E, 4gi7:F, 4gi7:G, 4gi7:H, 4ne2:A, 4ne2:B, 1sq5:A, 1sq5:B, 1sq5:C, 1sq5:D
15	8tr2:A	745	68	0.0709	0.0282	0.3088	7.1	2e4u:A, 2e4u:B, 2e4v:A, 2e4v:B, 2e4w:A, 2e4w:B, 2e4x:A, 2e4x:B, 2e4y:A, 2e4y:B, 8tqb:A, 8tqb:B, 8tr0:B, 8tr2:B, 8trc:A, 8trc:B, 8trd:A, 8trd:B, 7wi6:A, 7wi6:B, 7wi8:A, 7wi8:B
16	8xqw:M	390	29	0.0473	0.0359	0.4828	7.5	8xqx:M
17	6q2e:A	330	62	0.0507	0.0455	0.2419	9.3	6q2d:A, 6q2d:B, 6q2e:B

[Back]