SPAEHGYYMPAEWDSHAQTWIGWPERQDNWRHNALPAQRVFAGVAKAISKFEPVTVCASPAQWENARKQLPEDIRVVEMS
MNDSWFRDSGPTFIVRKRNRNIAGIDWNFNAWGGANDGCYNDWSHDLLVSRKILALERIPRFQHSMILEGGSIHVDGEGT
CLVTEECLLNKNRNPHMSKEQIEEELKKYLGVQSFIWLPRGLYGDEDTNGHIDNMCCFARPGVVLLSWTDDETDPQYERS
VEALSVLSNSIDARGRKIQVIKLYIPEPLYMTEEESSGITQDGEAIPRLAGTRLAASYVNFYIANGGIIAPQFGDPIRDK
EAIRVLSDTFPHHSVVGIENAREIVLAGGNIHCITQQQPAEPT
The query sequence (length=363) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3h7c:X | 369 | 363 | 1.0000 | 0.9837 | 1.0000 | 0.0 | 3h7k:A, 2q3u:A, 2q3u:B, 1vkp:A, 1vkp:B |
2 | 6nic:D | 360 | 359 | 0.7328 | 0.7389 | 0.7409 | 0.0 | 6nic:A, 6nic:C |
3 | 6b2w:A | 333 | 347 | 0.2617 | 0.2853 | 0.2738 | 8.24e-41 | 6b2w:B |
4 | 6i0x:B | 422 | 222 | 0.1267 | 0.1090 | 0.2072 | 3.91e-04 | 5ak7:A, 5ak8:A, 6i0x:A, 4ytb:A, 4ytg:A |
5 | 3pgb:A | 740 | 35 | 0.0358 | 0.0176 | 0.3714 | 5.0 | |
6 | 2eco:A | 302 | 28 | 0.0331 | 0.0397 | 0.4286 | 5.3 | 2ecq:A, 2efy:A, 2efy:B, 1ve1:A |
7 | 2fcr:A | 173 | 74 | 0.0551 | 0.1156 | 0.2703 | 5.5 |