SNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEIL
NKRLTEQLREKDT
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2eqb:C | 93 | 93 | 1.0000 | 1.0000 | 1.0000 | 2.72e-59 | |
2 | 5d3k:A | 269 | 50 | 0.1935 | 0.0669 | 0.3600 | 1.2 | 5d3z:A |
3 | 8her:B | 166 | 39 | 0.1505 | 0.0843 | 0.3590 | 1.9 | |
4 | 9fvt:A | 519 | 41 | 0.1720 | 0.0308 | 0.3902 | 3.9 | 9fvt:B, 9fvt:C, 9fvt:D |
5 | 4z38:B | 439 | 50 | 0.1720 | 0.0364 | 0.3200 | 5.5 | 4z38:A |
6 | 4pso:I | 221 | 29 | 0.1183 | 0.0498 | 0.3793 | 5.5 | 4pso:A, 4pso:B, 4pso:C, 4pso:D, 4pso:F, 4pso:G, 4pso:H |
7 | 1zg3:A | 358 | 43 | 0.1935 | 0.0503 | 0.4186 | 5.9 | 1zga:A, 1zgj:A, 1zhf:A |
8 | 2j68:A | 680 | 62 | 0.2366 | 0.0324 | 0.3548 | 6.3 | 2w6d:A, 2w6d:B |
9 | 5da8:M | 463 | 100 | 0.2903 | 0.0583 | 0.2700 | 7.3 | |
10 | 7vzg:a | 858 | 32 | 0.1183 | 0.0128 | 0.3438 | 8.6 | 7vzg:A, 7vzr:A, 7vzr:a |
11 | 7tra:A | 572 | 51 | 0.1828 | 0.0297 | 0.3333 | 9.2 | |
12 | 6z1p:AH | 177 | 55 | 0.1613 | 0.0847 | 0.2727 | 9.4 | |
13 | 6rjr:A | 505 | 38 | 0.1935 | 0.0356 | 0.4737 | 9.4 | 6rjr:B, 6rjr:C, 6rjr:D |