BioLiP

>protein
SNANDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGNSHPALDPKSRATLEHVLTVQGDLAAF
LVVARDMLLASL

The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5t6j:B	92	92	1.0000	1.0000	1.0000	2.98e-63	4geq:C, 4geq:A
2	5jy9:B	424	28	0.1304	0.0283	0.4286	1.0	2fn0:A, 2fn0:B, 2fn1:A, 2fn1:B, 5jy9:A
3	4p7a:A	303	34	0.1522	0.0462	0.4118	1.1
4	3vsu:A	638	63	0.2283	0.0329	0.3333	1.6	3vsu:B, 3vsu:C, 3vsu:D, 3vsv:A, 3vsv:B, 3vsv:D, 3vsv:C
5	8swy:A	248	48	0.1522	0.0565	0.2917	1.9	8swy:B, 8swz:A, 8swz:B
6	8r9b:A	301	70	0.2065	0.0631	0.2714	5.7	7b5o:J, 7b5q:J, 8orm:J, 8p4z:A, 8p4z:B, 8p6v:J, 8p6w:J, 8p6x:J, 8p6y:J, 8p6z:J, 8p70:J, 8p71:J, 8p72:J, 8p73:J, 8p74:J, 8p75:J, 8p76:J, 8p77:J, 8p78:J, 8p7l:J, 8plz:J, 8r99:A, 8r9a:A, 8r9b:B, 8r9b:C, 8r9b:D, 8r9o:A, 8r9o:B, 8r9s:A, 8r9s:B, 8r9u:A, 8r9u:B, 1ua2:A, 1ua2:B, 1ua2:C, 1ua2:D, 6xbz:J, 6xd3:J
7	5zvc:B	311	40	0.1413	0.0418	0.3250	6.3	6jyn:A, 6jyn:B, 6jyn:C, 6jyn:D, 6jys:A, 6jys:B, 6jys:C, 6jys:D, 5zvc:A
8	5iyp:B	306	35	0.1413	0.0425	0.3714	6.8	5iyp:A, 5iyq:A, 5iyq:B, 5iyr:A, 5iyr:B, 5iyw:A, 5iyw:B
9	2e7u:A	424	42	0.1413	0.0307	0.3095	8.0

[Back]