SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPE
LGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSF
DGGDQGILNTFFSSWATTDIRKHLPFIYNLSSILPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSTHPEFLILWWN
IFTTNVLPLLQ
The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3t7m:A | 263 | 263 | 1.0000 | 0.9544 | 0.9544 | 0.0 | 6eql:A, 6eql:B, 1ll2:A, 3qvb:A, 3rmv:A, 3rmw:A, 3t7m:B, 3t7n:A, 3t7n:B, 3t7o:A, 3t7o:B, 3u2t:A, 3u2u:A, 3u2u:B, 3u2v:A, 3u2v:B, 3u2w:A, 3u2w:B, 3u2x:A, 3u2x:B, 1zct:A, 1zct:B |
2 | 1zdf:A | 258 | 256 | 0.8964 | 0.8721 | 0.8789 | 1.38e-169 | 3v8z:A, 3v91:A, 1zdg:A |
3 | 4ueg:B | 249 | 256 | 0.6813 | 0.6867 | 0.6680 | 1.73e-123 | 4ueg:A |
4 | 6mw5:A | 239 | 250 | 0.3267 | 0.3431 | 0.3280 | 8.80e-36 | 6mw8:A |
5 | 5h60:A | 304 | 97 | 0.0797 | 0.0658 | 0.2062 | 0.043 | 7ym5:A |
6 | 5gvv:A | 392 | 138 | 0.1474 | 0.0944 | 0.2681 | 0.044 | 5gvv:F, 5gvw:C, 5gvw:A, 5gvw:B, 5gvw:D |
7 | 1kjv:A | 276 | 54 | 0.0757 | 0.0688 | 0.3519 | 1.4 | |
8 | 6u4b:A | 570 | 180 | 0.1713 | 0.0754 | 0.2389 | 3.7 | |
9 | 8snd:A | 500 | 62 | 0.0637 | 0.0320 | 0.2581 | 3.8 | 8snc:A, 8sne:A, 7sp6:A, 7sp7:A, 7sp8:A, 7sp9:A, 7spa:A |