SMRKTIERLLNSELSSNSIAVRTGVSQAVISKLRNGKKELGNLTLNSAEKLFEYQKEMEKVDTWIVYRGRTADMNKSYIA
EGSTYEEVYNNFVDKYGYDVLDEDIYEIQLLKKLEDYDYRELFENSSSQVYYHEFEITHE
The query sequence (length=140) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8jfu:C | 140 | 140 | 1.0000 | 1.0000 | 1.0000 | 1.01e-99 | |
2 | 8jfu:B | 171 | 171 | 1.0000 | 0.8187 | 0.8187 | 2.64e-92 | 8jfr:B, 8jfr:D, 8jfr:A, 8jfr:C, 8jft:C, 8jfu:D, 8jfu:A, 8jg9:C, 8jg9:F |
3 | 5o7h:B | 129 | 69 | 0.1286 | 0.1395 | 0.2609 | 0.94 | |
4 | 5o6u:B | 182 | 69 | 0.1286 | 0.0989 | 0.2609 | 1.1 | |
5 | 8cej:A | 449 | 98 | 0.1786 | 0.0557 | 0.2551 | 3.3 | 8cej:B, 8cej:C, 8cej:D, 8cek:A, 8cek:B, 8cek:C, 8cek:D |
6 | 8fpj:A | 1345 | 73 | 0.1571 | 0.0164 | 0.3014 | 3.3 | |
7 | 2xmo:A | 409 | 83 | 0.1429 | 0.0489 | 0.2410 | 3.6 | 2xmo:B |
8 | 7odr:M | 291 | 52 | 0.0929 | 0.0447 | 0.2500 | 4.2 | 7a5f:M3, 7a5g:M3, 7a5h:M, 7a5i:M3, 7a5j:M, 7a5k:M3, 5aj4:BP, 8any:M, 6gaw:BP, 6gb2:BP, 6i9r:M, 3j7y:M, 3j9m:M, 8k2a:LO, 8k2b:LO, 7l08:M, 7l20:M, 7nqh:BP, 7nql:BP, 7nsh:BP, 7nsi:BP, 7nsj:BP, 6nu2:M, 6nu3:M, 7o9k:M, 7o9m:M, 7ods:M, 7odt:M, 7of0:M, 7of2:M, 7of3:M, 7of4:M, 7of5:M, 7of6:M, 7of7:M, 7og4:XM, 7oi7:M, 7oi8:M, 7oi9:M, 7oia:M, 7oib:M, 7oic:M, 7oid:M, 7oie:M, 8oin:BT, 8oiq:BT, 8oir:BT, 8oit:BT, 5ool:M, 5oom:M, 7pd3:M, 8pk0:M, 7qh6:M, 7qh7:M, 7qi4:M, 7qi5:M, 7qi6:M, 8qsj:M, 8qu1:M, 8qu5:M, 4v19:P, 6vlz:M, 6vmi:M, 8xt0:LO, 8xt1:LO, 8xt2:LO, 8xt3:LO, 6ydp:BP, 6ydw:BP, 6zm5:M, 6zm6:M, 6zs9:XM, 6zsa:XM, 6zsb:XM, 6zsc:XM, 6zsd:XM, 6zse:XM, 6zsg:XM |
9 | 7po4:M | 269 | 52 | 0.0929 | 0.0483 | 0.2500 | 4.3 | 7oi6:M |
10 | 1ko7:A | 285 | 42 | 0.1000 | 0.0491 | 0.3333 | 4.5 | 1ko7:B |
11 | 7ok0:B | 1109 | 53 | 0.1429 | 0.0180 | 0.3774 | 8.1 | 7oq4:B, 7oqy:B |
12 | 7udm:B | 281 | 43 | 0.1071 | 0.0534 | 0.3488 | 8.4 | 7udl:A, 7udm:A |
13 | 7udm:B | 281 | 43 | 0.1071 | 0.0534 | 0.3488 | 8.4 | 7udl:A, 7udm:A |
14 | 7udm:B | 281 | 43 | 0.1071 | 0.0534 | 0.3488 | 8.4 | 7udl:A, 7udm:A |
15 | 6lty:A | 78 | 28 | 0.1000 | 0.1795 | 0.5000 | 9.8 | 6lty:B |