SMRKTIERLLNSELSSNSIAVRTGVSQAVISKLRNGKKELGNLTLNSAEKLFEYQKEMEKVD
The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8jfu:C | 140 | 62 | 1.0000 | 0.4429 | 1.0000 | 2.92e-38 | |
2 | 8jfu:B | 171 | 62 | 1.0000 | 0.3626 | 1.0000 | 4.76e-38 | 8jfr:B, 8jfr:D, 8jfr:A, 8jfr:C, 8jft:C, 8jfu:D, 8jfu:A, 8jg9:C, 8jg9:F |
3 | 1ko7:A | 285 | 44 | 0.2258 | 0.0491 | 0.3182 | 0.38 | 1ko7:B |
4 | 6f92:A | 760 | 48 | 0.2419 | 0.0197 | 0.3125 | 1.3 | 6f91:A, 6f91:B, 6f91:C, 6f91:D, 6f91:E, 6f91:F, 6f91:G, 6f91:H, 6f92:B, 6f92:C, 6f92:D |
5 | 7lgu:A | 680 | 24 | 0.1935 | 0.0176 | 0.5000 | 2.0 | 7lgu:B, 7lgw:A, 7lgw:B, 7lh2:A, 7lh2:B |
6 | 6lty:A | 78 | 28 | 0.2258 | 0.1795 | 0.5000 | 3.3 | 6lty:B |
7 | 5jm6:A | 445 | 21 | 0.1774 | 0.0247 | 0.5238 | 7.3 | 5jm6:E, 5jm6:F, 5jm6:B, 5jm6:C, 5jm6:D |
8 | 6mkh:A | 445 | 41 | 0.2419 | 0.0337 | 0.3659 | 7.8 | 6bsr:A, 6mki:A |
9 | 8des:A | 475 | 25 | 0.1452 | 0.0189 | 0.3600 | 9.6 |