Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SMRKTIERLLNSELSSNSIAVRTGVSQAVISKLRNGKKELGNLTLNSAEKLFEYQKEMEKV

The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8jfu:C 140 61 1.0000 0.4357 1.0000 2.42e-37
2 8jfu:B 171 61 1.0000 0.3567 1.0000 3.26e-37 8jfr:B, 8jfr:D, 8jfr:A, 8jfr:C, 8jft:C, 8jfu:D, 8jfu:A, 8jg9:C, 8jg9:F
3 1ko7:A 285 44 0.2295 0.0491 0.3182 0.37 1ko7:B
4 6f92:A 760 48 0.2459 0.0197 0.3125 1.3 6f91:A, 6f91:B, 6f91:C, 6f91:D, 6f91:E, 6f91:F, 6f91:G, 6f91:H, 6f92:B, 6f92:C, 6f92:D
5 7lgu:A 680 24 0.1967 0.0176 0.5000 1.9 7lgu:B, 7lgw:A, 7lgw:B, 7lh2:A, 7lh2:B
6 6lty:A 78 29 0.2295 0.1795 0.4828 3.5 6lty:B
7 6mkh:A 445 41 0.2459 0.0337 0.3659 6.0 6bsr:A, 6mki:A
8 5jm6:A 445 21 0.1803 0.0247 0.5238 7.1 5jm6:E, 5jm6:F, 5jm6:B, 5jm6:C, 5jm6:D
9 8des:A 475 25 0.1475 0.0189 0.3600 9.3

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417