SMLYLLDKSDYPKVKHLVRTKEEKSDVPLNAVINGTNVGNIYVDDPDHPKAALVDAVGTTCFLIGDASSPVFGEHLKDCI
ENQLKDQCLESGGSYFIATLFDKEWEKVLENAISHREYEPDYEFYHEFDKDKFNKVKSNYRSLTNEYTIKRMDKELIQND
SDDTLRSCLSDFWDSIDDFLTKGVGFCVIKDEQVISSCFTCYVDGNNHEISVETYDEEEQNKGLATKACEVYLEYCIENG
ITPHWSTFETNVESVNLASKLGFEYRFKLKTYEFEY
The query sequence (length=276) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7b3a:A | 276 | 276 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 3ll9:B | 249 | 35 | 0.0507 | 0.0562 | 0.4000 | 0.88 | 3ll9:A |
3 | 1mqq:A | 675 | 64 | 0.0616 | 0.0252 | 0.2656 | 1.2 | 1k9e:A, 1k9f:A, 1l8n:A |
4 | 3mmg:A | 217 | 69 | 0.0652 | 0.0829 | 0.2609 | 4.2 | 3mmg:B |
5 | 7ovu:A | 196 | 59 | 0.0616 | 0.0867 | 0.2881 | 5.4 | |
6 | 5kwk:B | 457 | 41 | 0.0507 | 0.0306 | 0.3415 | 6.7 | 5koe:A, 5kor:B, 5kor:C, 5kor:A, 5kor:D, 5kwk:A, 5kx6:A, 5kx6:B |
7 | 8wnf:A | 918 | 115 | 0.0942 | 0.0283 | 0.2261 | 10.0 | 8wng:A, 8wni:A, 8wnj:A, 8wo2:A, 8wo3:A |