SMELYNIKYAIDPTNKIVIEQVDNVDAFVHILEPGQEVFDETLSQYHQFPGVVSSIIFPQLVLNTIISVLSEDGSLLTLK
The query sequence (length=228) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
6xb3:A |
234 |
234 |
1.0000 |
0.9744 |
0.9744 |
1.03e-169 |
6xb3:B, 6xb3:C, 6xb3:D, 6xb3:E, 6xb3:F, 6xb3:G, 6xb3:H, 6xb3:I, 6xb3:J, 6xb3:K, 6xb3:L, 6xb3:M, 6xb3:N, 6xb3:O, 6xb3:P |
2 |
6ea8:A |
195 |
156 |
0.1930 |
0.2256 |
0.2821 |
0.010 |
6ea8:B, 6ea8:E, 6ea8:F, 6ea8:G, 6ea8:H, 6ea9:A, 6ea9:B, 6ea9:C, 6ea9:D, 6ea9:E, 8orv:A, 8p44:A, 8p44:B, 8p44:C, 8p44:D |
3 |
4ew2:A |
205 |
46 |
0.0833 |
0.0927 |
0.4130 |
2.3 |
4ew3:A, 8fdx:A, 8fdy:A, 8fdz:A, 8fe0:A, 8fjv:A, 8fjw:A, 8fjx:A, 8fjy:A, 5j9f:A, 7jg0:A, 7jg3:A, 7jg4:A, 1men:A, 1men:B, 1men:C, 1njs:A, 1njs:B, 1rbm:A, 1rbm:B, 1rbq:A, 1rbq:B, 1rbq:C, 1rbq:D, 1rby:A, 1rby:B, 1rby:C, 1rby:D, 1rbz:A, 1rbz:B, 1rc0:A, 1rc0:B, 1rc1:A, 1rc1:B, 1zly:A, 4zyt:A, 4zyu:A, 4zyv:A, 4zyw:A, 4zyx:A, 4zyy:A, 4zyz:A, 4zz0:A, 4zz1:A, 4zz2:A, 4zz3:A |
4 |
8acc:A |
231 |
52 |
0.0877 |
0.0866 |
0.3846 |
2.5 |
|
5 |
4eu5:A |
513 |
94 |
0.1053 |
0.0468 |
0.2553 |
4.1 |
5ddk:A, 5ddk:B, 5dw4:B, 5dw4:A, 5dw5:A, 5dw5:B, 5dw6:A, 5dw6:B, 5e5h:A, 5e5h:B, 4eu3:B, 4eu4:A, 4eu4:B, 4eu5:B, 4eu6:A, 4eu6:B, 4eu7:A, 4eu7:B, 4eu8:A, 4eu8:B, 4eu9:A, 4eu9:B, 4eua:A, 4eua:B, 4eub:A, 4eub:B, 4euc:A, 4euc:B, 4eud:A, 4eud:B |
6 |
6xyw:Ac |
218 |
83 |
0.0877 |
0.0917 |
0.2410 |
6.0 |
|
7 |
6bhn:A |
156 |
55 |
0.0658 |
0.0962 |
0.2727 |
6.6 |
6bho:A |
8 |
3w2z:A |
178 |
30 |
0.0482 |
0.0618 |
0.3667 |
6.8 |
5zoh:A |
9 |
6c9h:B |
168 |
70 |
0.0789 |
0.1071 |
0.2571 |
7.7 |
6e4t:B, 6e4u:B, 6e4w:B, 5kq5:B, 4qfr:B, 4qfs:B, 5t5t:B, 5ufu:B |
10 |
6vfr:A |
428 |
64 |
0.0965 |
0.0514 |
0.3438 |
8.6 |
6vfr:B |