BioLiP

>protein
SMDIEFMAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLH
LYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYG
RIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQ
VSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGL
LKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARF
PAFEL

The query sequence (length=405) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3e6u:A	409	405	1.0000	0.9902	1.0000	0.0	8czk:A, 8czk:B, 8czl:A, 8czl:B, 8d0v:A, 8d0v:B, 8d19:A, 8d19:B, 3e6u:C, 3e6u:B, 3e6u:D, 3e73:A, 3e73:B
2	6wq1:A	396	400	0.5630	0.5758	0.5700	1.54e-172	6wq1:B, 6wq1:C, 6wq1:D
3	3t33:A	407	373	0.3605	0.3587	0.3914	2.57e-75
4	6st5:A	913	388	0.1951	0.0865	0.2036	0.002
5	8byk:A	437	85	0.0568	0.0526	0.2706	0.16
6	2fdc:A	505	83	0.0642	0.0515	0.3133	0.81
7	2g02:A	404	190	0.0963	0.0965	0.2053	0.91	2g0d:A
8	6o8h:A	571	83	0.0642	0.0455	0.3133	1.0	6o8g:B, 6o8g:C
9	6o8e:A	592	83	0.0642	0.0439	0.3133	1.0	1d9z:A, 2fdc:B, 6o8e:B, 6o8f:A, 6o8f:B, 6o8g:A
10	5u7w:A	404	26	0.0321	0.0322	0.5000	3.5	5u7v:A
11	3bs0:A	414	94	0.0691	0.0676	0.2979	6.2	3brz:A, 3bs0:B
12	8sam:A	859	42	0.0321	0.0151	0.3095	6.5	8sam:B, 8sao:B, 8sao:D
13	7dia:A	1072	62	0.0395	0.0149	0.2581	6.9	3s5k:A, 8wyt:A, 8wyx:A, 8wyy:A
14	6oxd:A	736	53	0.0395	0.0217	0.3019	6.9	6oxc:A
15	3s5m:A	1094	62	0.0395	0.0146	0.2581	7.0	7di7:A, 7dij:A, 8ho4:A, 8ho5:A, 3s5h:A, 7vpe:A, 8wxw:A, 8wxz:A, 8wyu:A

[Back]