SMAMFYAHALGGYDENLHAFPGISSTVANDVRKYSVVSVYNNKYDIVKDKYMWCYSQVNKRYIGALLPMFECNEYLQIGD
PIHDQEGNQISIITYRHKNYYALSGIGYESLDLCLEGVGIHHHVLETGNAVYGKVQHDYSTIKEKAKEMNALSPGPIIDY
HVWIGDCICQVTAVDVHGKEIMRMRFKKGAVLPIP
The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ea8:A | 195 | 195 | 1.0000 | 1.0000 | 1.0000 | 2.93e-147 | 6ea8:B, 6ea8:E, 6ea8:F, 6ea8:G, 6ea8:H, 6ea9:A, 6ea9:B, 6ea9:C, 6ea9:D, 6ea9:E, 8orv:A, 8p44:A, 8p44:B, 8p44:C, 8p44:D |
2 | 6xb3:A | 234 | 193 | 0.2615 | 0.2179 | 0.2642 | 0.002 | 6xb3:B, 6xb3:C, 6xb3:D, 6xb3:E, 6xb3:F, 6xb3:G, 6xb3:H, 6xb3:I, 6xb3:J, 6xb3:K, 6xb3:L, 6xb3:M, 6xb3:N, 6xb3:O, 6xb3:P |
3 | 6xb5:A | 240 | 37 | 0.0718 | 0.0583 | 0.3784 | 0.008 | 6xb5:B |
4 | 7dfu:A | 191 | 85 | 0.1231 | 0.1257 | 0.2824 | 1.1 | 7dfu:B, 7dfu:C, 7dfu:D, 7dfu:E, 7dfu:F, 7dfu:G |
5 | 6nun:A | 516 | 47 | 0.0769 | 0.0291 | 0.3191 | 3.5 | |
6 | 1mio:A | 525 | 37 | 0.0769 | 0.0286 | 0.4054 | 4.5 | 1mio:C, 5vpw:A, 5vq3:A, 5vq3:C, 4wes:A, 4wes:C, 4wn9:A, 4wn9:C |
7 | 5vpw:C | 495 | 37 | 0.0769 | 0.0303 | 0.4054 | 5.4 | |
8 | 6et7:A | 646 | 85 | 0.1179 | 0.0356 | 0.2706 | 5.7 | 6et7:B |
9 | 3fr8:B | 517 | 88 | 0.1077 | 0.0406 | 0.2386 | 5.8 | 3fr7:A, 3fr7:B, 3fr8:A |
10 | 5llw:B | 673 | 85 | 0.1179 | 0.0342 | 0.2706 | 5.8 | 5llw:A, 5llx:A, 5llx:B, 5lly:D, 5lly:A, 5lly:C, 5lly:B, 6saw:A, 6saw:B, 6saw:C, 6saw:D, 6saw:E, 6saw:F, 6saw:G, 6saw:H, 6sax:B, 6sax:A |
11 | 1hl7:A | 279 | 47 | 0.0821 | 0.0573 | 0.3404 | 7.4 | 1hl7:B |
12 | 4v02:A | 244 | 61 | 0.0769 | 0.0615 | 0.2459 | 8.0 | 4v02:B, 4v03:A, 4v03:B |
13 | 3ryb:A | 563 | 39 | 0.0667 | 0.0231 | 0.3333 | 9.3 | 3drf:A, 3drg:A, 3drh:A, 3dri:A, 3drj:A, 3drk:A, 3rya:A |