SLSWEIEELDREIGKIKKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPLQLIIRILSRFGVDVIKYLEN
HRLAIVDTFGSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKKVWMDLNLFEGRELYGFAISMSGYLEVFTPEETLRYL
ETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRRADYVLKTRSSLGENGIKRELLVIKTPKVRFEYEFKGNEPK
LRREG
The query sequence (length=245) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3bs4:A | 245 | 245 | 1.0000 | 1.0000 | 1.0000 | 8.89e-180 | |
2 | 8ci5:A | 1258 | 45 | 0.0653 | 0.0127 | 0.3556 | 0.86 | |
3 | 6xjj:A | 291 | 74 | 0.0857 | 0.0722 | 0.2838 | 2.3 | |
4 | 7xi3:B | 314 | 53 | 0.0653 | 0.0510 | 0.3019 | 2.5 | 7xhv:B, 7xi4:B |
5 | 3i58:A | 328 | 68 | 0.0857 | 0.0640 | 0.3088 | 2.6 | 3i53:A, 3i53:B, 3i58:B, 3i5u:A, 3i5u:B, 3i64:A, 3i64:B |
6 | 8ro2:I | 753 | 43 | 0.0531 | 0.0173 | 0.3023 | 3.3 | |
7 | 6d8v:A | 269 | 39 | 0.0612 | 0.0558 | 0.3846 | 3.8 | |
8 | 6v8q:A | 569 | 40 | 0.0531 | 0.0228 | 0.3250 | 4.7 | 6v8q:B, 6vat:A, 6vat:B, 6vat:C, 6vc7:A, 6vc7:B, 6vc7:C, 6vc7:D, 6vc7:E, 6vc7:F, 6vdf:A, 6vdf:C, 6vdf:D |
9 | 8qh3:A | 1310 | 45 | 0.0571 | 0.0107 | 0.3111 | 5.2 | 8c4u:A, 8c4v:A, 8p1m:A, 8p1n:A, 8qgt:A |
10 | 6tmf:E | 178 | 36 | 0.0571 | 0.0787 | 0.3889 | 6.5 | |
11 | 7tby:A | 1788 | 63 | 0.0653 | 0.0089 | 0.2540 | 7.9 | 7tc0:A |