SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK
The query sequence (length=50) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5hvz:A | 50 | 50 | 1.0000 | 1.0000 | 1.0000 | 2.26e-31 | 5hvz:B, 3im4:A, 3im4:B |
| 2 | 2fmt:A | 314 | 24 | 0.2600 | 0.0414 | 0.5417 | 0.93 | 2fmt:B |
| 3 | 8axc:B | 532 | 40 | 0.2600 | 0.0244 | 0.3250 | 1.1 | 8axc:A, 8axc:C, 8axc:D |
| 4 | 2i3g:A | 347 | 22 | 0.2000 | 0.0288 | 0.4545 | 1.4 | 2i3g:B, 7nnq:A, 7nnq:B, 7nnq:C, 7nnq:D, 7nnr:A, 7nnr:B, 7not:A, 7not:B, 7not:C, 7not:D, 7nph:C, 7npj:B |
| 5 | 6k6s:A | 443 | 32 | 0.2000 | 0.0226 | 0.3125 | 3.1 | 6k6s:B |
| 6 | 6ikg:A | 644 | 20 | 0.1800 | 0.0140 | 0.4500 | 4.6 | 6ikg:B |
| 7 | 6bhd:A | 217 | 20 | 0.1800 | 0.0415 | 0.4500 | 7.0 | 6au2:A, 6au3:A, 6bhe:A, 6bhg:A, 6bhh:A, 6bhi:A, 6bpi:A, 7c9n:B, 7c9n:A, 7caj:D, 7caj:A, 7cd9:A, 7cd9:B, 7cjt:D, 7cjt:A, 7cjt:B, 7cjt:C, 8g5e:A, 5kch:A, 5kco:A, 5ke2:A, 5ke3:A, 5kh6:A, 5qt1:A, 5qt2:A, 8uwp:A, 8uwp:B |
| 8 | 8k21:E | 295 | 24 | 0.2000 | 0.0339 | 0.4167 | 8.1 | 8k21:d, 8k21:e, 8k21:D, 8k22:E, 8k22:d, 8k22:e, 8k22:D, 8k23:E, 8k23:d, 8k23:e, 8k23:D, 8k24:d, 8k24:e, 8k24:E, 8k24:D, 8k25:d |
| 9 | 7x8k:B | 367 | 37 | 0.2600 | 0.0354 | 0.3514 | 8.9 | 7x8k:A, 7x8k:D |
| 10 | 3cb0:A | 166 | 37 | 0.2200 | 0.0663 | 0.2973 | 9.2 | 3cb0:B, 4ira:A |
| 11 | 3r8x:A | 309 | 63 | 0.4000 | 0.0647 | 0.3175 | 9.4 | |
| 12 | 6flo:A | 277 | 20 | 0.1800 | 0.0325 | 0.4500 | 10.0 | 6flo:B, 6h4g:A, 6h4g:B |
umich.edu