SLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPW
VKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAI
LDRRNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGT
ATYQLLVALHHP
The query sequence (length=252) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6f7h:C | 253 | 251 | 0.9960 | 0.9921 | 1.0000 | 0.0 | 6f7h:A, 6f7h:B |
2 | 8c9h:A | 253 | 245 | 0.4286 | 0.4269 | 0.4408 | 1.26e-72 | 8c9h:B, 8c9h:C, 8c9h:D, 8c9h:E, 8c9h:F, 8c9h:G, 8c9h:H, 6n1g:A, 6n1g:C, 6n1g:B, 6n1g:D, 6qzi:A, 6qzj:A |
3 | 1fx8:A | 254 | 254 | 0.3770 | 0.3740 | 0.3740 | 3.50e-45 | |
4 | 3c02:A | 242 | 245 | 0.3452 | 0.3595 | 0.3551 | 3.60e-40 | |
5 | 8jy6:A | 242 | 241 | 0.3294 | 0.3430 | 0.3444 | 2.19e-37 | 8jy6:B, 8jy6:C, 8jy6:D, 8jy8:A, 8jy8:B, 8jy8:C, 8jy8:D |
6 | 2evu:A | 245 | 265 | 0.3175 | 0.3265 | 0.3019 | 3.48e-23 | 2f2b:A |
7 | 8uy6:A | 244 | 218 | 0.2302 | 0.2377 | 0.2661 | 2.62e-09 | 3nka:A, 2o9e:A, 8uy6:C, 8uy6:E, 8uy6:G, 8uy6:I, 8uy6:K, 8uy6:M, 8uy6:O |
8 | 8ct2:D | 247 | 256 | 0.2500 | 0.2551 | 0.2461 | 1.39e-08 | 8ct2:B, 8ct2:C, 8ct2:A, 8cte:O, 8cte:S, 8cte:R, 8cte:M, 7uze:D, 7uze:B, 7uze:C, 7uze:A |
9 | 8sjx:A | 220 | 212 | 0.2024 | 0.2318 | 0.2406 | 1.42e-07 | 8sjy:A |
10 | 4nef:A | 239 | 244 | 0.2381 | 0.2510 | 0.2459 | 1.70e-06 | |
11 | 5dye:D | 253 | 244 | 0.2381 | 0.2372 | 0.2459 | 2.51e-05 | 5c5x:A, 5c5x:B, 5c5x:C, 5c5x:D, 5c5x:E, 5c5x:H, 3d9s:C, 3d9s:D, 5dye:A, 5dye:B, 5dye:C |
12 | 5bn2:A | 260 | 251 | 0.2103 | 0.2038 | 0.2112 | 0.011 | |
13 | 5x8f:B | 485 | 68 | 0.0913 | 0.0474 | 0.3382 | 1.7 | 5buq:B, 5bur:A, 5bur:B, 5bus:A, 5bus:B, 5gtd:A, 5gtd:B, 5x8f:A, 5x8f:C, 5x8f:D, 5x8g:A, 5x8g:B, 5x8g:D, 5x8g:C |
14 | 1txg:A | 335 | 54 | 0.0794 | 0.0597 | 0.3704 | 2.3 | 1txg:B |
15 | 5lqw:A | 2130 | 118 | 0.1190 | 0.0141 | 0.2542 | 3.0 | |
16 | 7abr:D | 586 | 109 | 0.1190 | 0.0512 | 0.2752 | 4.9 | 7abr:A, 7abr:B, 7abr:C, 7abr:E |