SLKLGAIFLEGITVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIRLLEQKPYKVSWKADGTRYMMLI
DGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDKVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCI
EREIISPRHEKMKTGLIDKTQEPFSVRPKQFFDINISRKLLEGNMDGLIFQPIGKYKPGRCDDILKWKPPSLCNSISNPV
TKEMLFEFIDRCAA
The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rtx:A | 262 | 264 | 0.9921 | 0.9618 | 0.9545 | 0.0 | 3rtx:B |
2 | 8p4a:M | 507 | 228 | 0.8228 | 0.4122 | 0.9167 | 4.25e-152 | 8p4b:M, 8w8e:a |
3 | 8p4a:M | 507 | 22 | 0.0787 | 0.0394 | 0.9091 | 2.83e-06 | 8p4b:M, 8w8e:a |
4 | 4pz6:A | 373 | 243 | 0.2677 | 0.1823 | 0.2798 | 1.13e-17 | 4pz6:B, 4pz8:A |
5 | 1p16:A | 390 | 222 | 0.2520 | 0.1641 | 0.2883 | 5.22e-17 | 1p16:B |
6 | 1ckm:A | 317 | 166 | 0.1614 | 0.1293 | 0.2470 | 1.42e-08 | 1ckm:B, 1ckn:A, 1cko:A |
7 | 3gf0:A | 199 | 49 | 0.0669 | 0.0854 | 0.3469 | 3.5 | 2hxd:A, 1pkj:B, 1pkk:B |
8 | 1q33:A | 292 | 62 | 0.0630 | 0.0548 | 0.2581 | 3.8 | 1qvj:A |
9 | 7b1w:F | 234 | 77 | 0.0827 | 0.0897 | 0.2727 | 6.5 | 7b1w:J, 7b1w:A, 7b1w:B, 7b1w:C, 7b1w:D, 7b1w:E, 7b1w:G, 7b1w:H, 7b1w:I, 7b1w:K, 7b1w:L |
10 | 7a4l:A | 54 | 23 | 0.0276 | 0.1296 | 0.3043 | 6.8 | 7a58:A, 6xyv:A |
11 | 8wa1:B | 998 | 36 | 0.0472 | 0.0120 | 0.3333 | 7.6 | |
12 | 8wa0:B | 973 | 36 | 0.0472 | 0.0123 | 0.3333 | 8.0 | 8w9z:B |