BioLiP

>protein
SLIYQIAKEFDFCYGHRVWSQELNPDFSLDPCLSCRHLHGHQGKVIVHLESRELQRGMVTDFAHLNWFKRFIDEVLDHRF
IIDIDDPLFPTLLPHFADKSALVWMEEGYARVDFERIKGESSPILELYESFVVVRFVPTSESIASWLLELLRSRIQPLGV
KVSSVEFLETPKSRARVYNE

The query sequence (length=180) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3jyg:A	180	180	1.0000	1.0000	1.0000	4.74e-133	3jyg:B, 3jyg:C, 3jyg:D, 3jyg:E, 3jyg:F
2	2oba:B	121	59	0.1167	0.1736	0.3559	0.001	2oba:A, 2oba:C, 2oba:D, 2oba:E, 2oba:F
3	1b66:A	138	97	0.1444	0.1884	0.2680	0.020	1b66:B, 1b6z:A, 1b6z:B, 1gtq:A, 1gtq:B
4	3ghg:B	401	73	0.1389	0.0623	0.3425	0.25	3bvh:E, 3bvh:B, 3e1i:B, 3e1i:E, 2ffd:E, 2ffd:B, 1fzc:B, 1fzc:E, 1fze:B, 1fze:E, 1fzf:B, 1fzf:E, 1fzg:B, 1fzg:E, 3ghg:E, 3ghg:H, 3ghg:K, 3h32:B, 3h32:E, 2h43:B, 2h43:E, 2hlo:B, 2hlo:E, 2hod:B, 2hod:E, 2hod:H, 2hod:K, 2hpc:B, 2hpc:E, 2hpc:H, 2hpc:K, 3hus:B, 3hus:E, 1lt9:B, 1lt9:E, 1ltj:B, 1ltj:E, 1n86:B, 1n86:E, 2oyh:B, 2oyh:E, 2oyi:B, 2oyi:E, 2q9i:B, 2q9i:E, 1re3:B, 1re3:E, 1re4:B, 1re4:E, 1rf0:B, 1rf0:E, 1rf1:B, 1rf1:E, 2z4e:B, 2z4e:E
5	2a0s:A	163	146	0.1944	0.2147	0.2397	0.33	2a0s:B, 3lx3:A, 3lze:A, 3m0n:A
6	5m0r:A	276	46	0.0833	0.0543	0.3261	0.59	3hpg:A, 3hpg:B, 3hpg:C, 3hpg:D, 3hpg:E, 3hpg:F, 3hph:A, 3hph:B, 3hph:C, 3hph:D, 5m0r:D, 5m0r:I, 5m0r:L, 5m0r:N, 5m0r:E, 5m0r:F, 5m0r:M, 7u32:I, 7u32:N, 7u32:A, 7u32:F, 7u32:B, 7u32:C, 7u32:E, 7u32:G, 7u32:J, 7u32:K, 7u32:M, 7u32:O, 7z1z:A, 7z1z:I, 7z1z:N, 7z1z:F, 7z1z:B, 7z1z:C, 7z1z:E, 7z1z:G, 7z1z:J, 7z1z:K, 7z1z:M, 7z1z:O, 7zpp:A, 7zpp:I
7	7z1z:D	252	46	0.0833	0.0595	0.3261	0.64	7z1z:L
8	1y13:A	163	56	0.0944	0.1043	0.3036	5.4	1y13:C, 1y13:B
9	4eom:C	276	26	0.0500	0.0326	0.3462	5.7	4bco:C, 4bcp:C, 3bht:C, 3bhu:C, 3bhv:C, 4cfm:C, 4cfu:C, 4cfv:C, 3ddq:C, 3dog:C, 4eoq:C, 4eor:C, 2g9x:C, 2iw8:C, 2iw9:C, 5lmk:C, 3my5:C, 1ogu:C, 1oiu:C, 7uxk:A
10	8afz:B	376	77	0.1000	0.0479	0.2338	8.6	8a1g:D, 5tgh:A, 5tgh:E, 5tgh:C, 5tgh:G, 5tgi:A, 5tgi:B, 5tgj:A, 5tgj:C, 5tp1:A, 5tp1:B, 5tp1:C, 5tp1:D, 5wy2:A, 5wy2:C
11	2dtt:B	115	20	0.0500	0.0783	0.4500	9.9	2dtt:A, 2dtt:C, 2dtt:D, 2dtt:F, 2dtt:E

[Back]