SLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHE
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ny2:D | 73 | 71 | 1.0000 | 0.9726 | 1.0000 | 3.79e-49 | 3ny2:A, 3ny2:B, 3ny2:C, 3ny2:E, 3ny2:F, 3ny2:G, 3ny2:H, 3ny3:A, 5tda:A, 5tdb:A, 5tdd:A, 5um3:A |
2 | 3ny1:A | 73 | 71 | 0.7606 | 0.7397 | 0.7606 | 3.95e-38 | 3ny1:B, 5tdc:A, 5tdc:C |
3 | 7mex:A | 1737 | 71 | 0.4648 | 0.0190 | 0.4648 | 2.89e-19 | 6kgi:B, 7mey:A, 3nih:A, 3nii:A, 3nij:A, 3nik:B, 3nik:D, 3nik:A, 3nik:F, 3nil:D, 3nil:A, 3nil:B, 3nil:F, 3nim:B, 3nim:F, 3nim:A, 3nim:D, 3nin:A, 3nin:B, 3nis:A, 3nis:B, 3nis:D, 3nis:F, 3nit:A |
4 | 7wul:A | 70 | 71 | 0.4507 | 0.4571 | 0.4507 | 1.05e-17 | 7wuk:A, 7wum:A, 7wun:A |
5 | 7y70:A | 77 | 59 | 0.3803 | 0.3506 | 0.4576 | 5.10e-13 | 6lhn:A, 7xwd:A, 7xwe:A, 7xwe:B, 7xwf:A, 7xwg:A, 7xwg:B, 7y6w:A, 7y6x:A, 7y6x:B, 7y6x:D, 7y6x:E, 7y6x:F, 7y6x:G, 7y6x:H, 7y6x:C, 7y6y:A, 7y6y:B, 7y6y:C, 7y6y:D, 7y6z:A |
6 | 8bja:B | 1638 | 47 | 0.1549 | 0.0067 | 0.2340 | 0.062 | |
7 | 8bja:A | 1563 | 47 | 0.1549 | 0.0070 | 0.2340 | 0.071 | |
8 | 8p82:A | 1596 | 47 | 0.1549 | 0.0069 | 0.2340 | 0.071 | 8p82:B |
9 | 8e0q:A | 1689 | 47 | 0.1549 | 0.0065 | 0.2340 | 0.071 | 8d4x:A, 8e0q:B |
10 | 8ewi:A | 1775 | 47 | 0.1549 | 0.0062 | 0.2340 | 0.072 | 8ewi:B, 8ewi:C, 8ewi:D |
11 | 8d4x:B | 1669 | 47 | 0.1549 | 0.0066 | 0.2340 | 0.072 | 8c06:A, 8c06:D |
12 | 7mf3:D | 158 | 36 | 0.1831 | 0.0823 | 0.3611 | 0.14 | 7mf3:E, 6z47:E, 6z47:F |
13 | 8e9b:B | 387 | 23 | 0.1549 | 0.0284 | 0.4783 | 0.58 | 8uxw:B, 8uxx:B, 6w17:B, 6w18:B |
14 | 7mju:A | 184 | 26 | 0.1831 | 0.0707 | 0.5000 | 2.6 | 5dag:A, 5dah:B, 5dah:A |
15 | 8ge0:A | 188 | 28 | 0.1831 | 0.0691 | 0.4643 | 3.1 | 8gdx:A, 8ge0:B, 8ge0:C |
16 | 6f8z:A | 715 | 20 | 0.1408 | 0.0140 | 0.5000 | 4.4 | 6f8z:B, 6f8z:C, 6f90:A, 6f90:B, 6f90:C |
17 | 4c2j:D | 395 | 16 | 0.0986 | 0.0177 | 0.4375 | 9.1 | 4c2j:A, 4c2j:B, 4c2j:C |
18 | 6kqs:A | 620 | 38 | 0.1831 | 0.0210 | 0.3421 | 9.2 | 6kqt:A |