SLAQIKSLFATRLYHAPLSEHGPALDPAEFAASCYSIAEDDDAGQEWCEREGYPGYTSYASLTDLPWRFPIFADLVKSLD
AHVAAFAEDLEFELDGKALRLEDIWINILPEGGVHGSHIHPHSVISGTTYVAMPEGTSALKLEDPRLPFMMAAPTRRKGA
REELRTFRSVAPKVGDVLLWESWLRHEVPMNMAEEDRISVSFNYAW
The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2rg4:A | 206 | 206 | 1.0000 | 1.0000 | 1.0000 | 8.29e-154 | 2rg4:B |
2 | 3bvc:A | 203 | 200 | 0.8010 | 0.8128 | 0.8250 | 2.43e-123 | |
3 | 3ggg:D | 293 | 70 | 0.1019 | 0.0717 | 0.3000 | 0.24 | 2g5c:A, 2g5c:B, 2g5c:C, 2g5c:D, 3ggg:A, 3ggg:B, 3ggg:C, 3ggo:A, 3ggo:B, 3ggo:D, 3ggo:C, 3ggp:A, 3ggp:B, 3ggp:D, 3ggp:C |
4 | 4csw:A | 388 | 59 | 0.0971 | 0.0515 | 0.3390 | 0.39 | 4csw:B, 4cug:A, 4cug:B |
5 | 8csp:W | 98 | 33 | 0.0631 | 0.1327 | 0.3939 | 1.7 | 8csq:W |
6 | 4xcb:A | 260 | 40 | 0.0680 | 0.0538 | 0.3500 | 1.7 | 4xca:A, 4xca:B, 4xca:C, 4xca:D, 4xcb:B, 4xcb:C, 4xcb:D, 4zpi:A, 4zpi:B, 4zpi:C, 4zpi:D |
7 | 3a79:B | 525 | 29 | 0.0680 | 0.0267 | 0.4828 | 3.4 | |
8 | 6tzz:A | 277 | 42 | 0.0485 | 0.0361 | 0.2381 | 8.3 | 6tzy:A, 6tzy:B, 6tzy:C, 6tzy:D, 6tzz:B |