SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELS
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7f1t:A | 423 | 66 | 0.9559 | 0.1537 | 0.9848 | 5.72e-41 | 6akx:A, 6akx:B, 6aky:A, 5d65:B, 5d65:A, 5d65:D, 4mbs:A, 4mbs:B, 5uiw:A |
2 | 6fgp:B | 68 | 66 | 0.4559 | 0.4559 | 0.4697 | 1.39e-21 | 1b3a:B, 1b3a:A, 5coy:A, 5dnf:C, 5dnf:D, 5dnf:I, 5dnf:A, 5dnf:F, 5dnf:G, 5dnf:H, 1u4l:A, 1u4m:A |
3 | 2ra4:B | 65 | 63 | 0.3824 | 0.4000 | 0.4127 | 2.28e-16 | |
4 | 4r8i:A | 68 | 65 | 0.3824 | 0.3824 | 0.4000 | 4.26e-13 | |
5 | 2mpm:A | 74 | 64 | 0.3824 | 0.3514 | 0.4062 | 1.41e-12 | |
6 | 2hci:A | 68 | 58 | 0.3088 | 0.3088 | 0.3621 | 4.41e-07 | |
7 | 1ilp:A | 71 | 54 | 0.2353 | 0.2254 | 0.2963 | 0.001 | 1ilq:A, 6xmn:A |
8 | 2nwg:A | 68 | 33 | 0.1765 | 0.1765 | 0.3636 | 0.008 | 2nwg:B, 4uai:A |
9 | 7xbx:R | 349 | 56 | 0.2353 | 0.0458 | 0.2857 | 0.097 | 7xbw:R |
10 | 3wis:A | 180 | 64 | 0.2647 | 0.1000 | 0.2812 | 2.9 | |
11 | 5ol0:B | 263 | 40 | 0.2059 | 0.0532 | 0.3500 | 4.4 | |
12 | 5ol0:A | 283 | 40 | 0.2059 | 0.0495 | 0.3500 | 4.4 |