SKWIDRRSTRVPHNGKDIWYFGDQPSCALCHIRFRYKQDYEAHKESELHVNRLRWVETMNWWRETGEPAYLKASNEQWEW
FEQHVLPTKAQEMGCTLDEARRVYRQAIMTETPTWHRPLQCPTVKQEVQEPRDQRWPASPKW
The query sequence (length=142) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aih:Ay | 142 | 142 | 1.0000 | 1.0000 | 1.0000 | 1.15e-105 | 7ane:Ay |
2 | 6hiv:BY | 102 | 102 | 0.4225 | 0.5882 | 0.5882 | 3.53e-39 | 6hix:BY |
3 | 6h5q:B | 381 | 45 | 0.1056 | 0.0394 | 0.3333 | 0.22 | 6h5s:C, 4uft:B |
4 | 7zm7:P | 122 | 48 | 0.1197 | 0.1393 | 0.3542 | 0.43 | 7zmb:P, 7zmg:P |
5 | 7ob9:A | 1535 | 89 | 0.1831 | 0.0169 | 0.2921 | 0.46 | 7oba:A |
6 | 2yrk:A | 55 | 43 | 0.0775 | 0.2000 | 0.2558 | 0.67 | |
7 | 4id9:B | 328 | 35 | 0.0845 | 0.0366 | 0.3429 | 0.92 | 4id9:A, 4idg:A, 4idg:B |
8 | 7caf:E | 443 | 60 | 0.1268 | 0.0406 | 0.3000 | 1.4 | 8hpl:E, 8hpm:E, 8hpn:E, 8hpr:E |
9 | 7obb:A | 1510 | 85 | 0.1690 | 0.0159 | 0.2824 | 1.8 | |
10 | 7oi3:E | 394 | 45 | 0.0915 | 0.0330 | 0.2889 | 2.0 | |
11 | 1fu9:A | 36 | 19 | 0.0634 | 0.2500 | 0.4737 | 2.1 | 1jn7:A |
12 | 1o98:A | 509 | 24 | 0.0634 | 0.0177 | 0.3750 | 3.2 | 1ejj:A, 1eqj:A, 1o99:A |
13 | 7vbc:A | 1477 | 85 | 0.1620 | 0.0156 | 0.2706 | 3.6 | 7vba:A, 7vbb:A |
14 | 4dg9:A | 575 | 20 | 0.0634 | 0.0157 | 0.4500 | 5.3 | 4dg8:A |
15 | 4pwa:D | 87 | 40 | 0.0915 | 0.1494 | 0.3250 | 8.4 | 4pw9:B, 4pwa:A, 4pwa:B, 4pwa:C |