SKLVLTGERHYTRNDDIRQSILALGQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNT
FSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFV
ELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLP
The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5z2w:A | 209 | 203 | 1.0000 | 0.9378 | 0.9655 | 2.41e-143 | 6h9n:A, 6h9o:A, 6h9o:C |
2 | 4v6m:AZ | 98 | 46 | 0.1990 | 0.3980 | 0.8478 | 7.45e-17 | |
3 | 1f0x:A | 502 | 85 | 0.1224 | 0.0478 | 0.2824 | 4.8 | 1f0x:B |
4 | 8bpl:A | 316 | 162 | 0.2143 | 0.1329 | 0.2593 | 5.2 | |
5 | 7ohg:A | 351 | 27 | 0.0561 | 0.0313 | 0.4074 | 5.6 | 6s2t:A, 6s2u:A, 6s2v:A |
6 | 4ekn:B | 304 | 41 | 0.0612 | 0.0395 | 0.2927 | 8.9 | |
7 | 3h0l:A | 478 | 114 | 0.1071 | 0.0439 | 0.1842 | 9.2 | 3h0l:D, 3h0l:G, 3h0l:J, 3h0l:M, 3h0l:P, 3h0l:S, 3h0l:V, 3h0m:A, 3h0m:D, 3h0m:G, 3h0m:J, 3h0m:M, 3h0m:P, 3h0m:S, 3h0m:V, 3h0r:A, 3h0r:D, 3h0r:G, 3h0r:J, 3h0r:M, 3h0r:P, 3h0r:S, 3h0r:V |