SKLIFVSMITRNGDRAPFANIENANYSWGTELSELTPIGMNQEYNLGLQLRKRYIDKFGLLPEHYVDQSIYVLSSHTNRT
VVSAQSLLMGLYPAGTGPLIGDGDPAIKDRFQPIPIMTLSADSRLIQFPYEQYLAVLKKYVYNSPEWQNKTKEAAPNFAK
WQQILGNRISGLNDVITVGDVLIVAQAHGKPLPKGLSQEDADQIIALTDWGLAQQFKSQKVSYIMGGKLTNRMIEDLNNA
VNGKSKYKMTYYSGHALTLLEVMGTLGVPLDTAPGYASNLEMELYKDGDIYTVKLRYNGKYVKLPIMDKNNSCSLDALNK
YMQSINEKF
The query sequence (length=329) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3it3:A | 337 | 329 | 0.9970 | 0.9733 | 0.9970 | 0.0 | 4e3w:A, 4e3w:B, 3it0:A, 3it0:B, 3it3:B |
2 | 7d2f:A | 328 | 321 | 0.3951 | 0.3963 | 0.4050 | 1.41e-77 | 7d2f:B |
3 | 1nd6:B | 343 | 333 | 0.2766 | 0.2653 | 0.2733 | 6.62e-21 | 1cvi:A, 1cvi:B, 1cvi:C, 1cvi:D, 2hpa:A, 2hpa:B, 2hpa:D, 1nd5:A, 1nd5:B, 1nd5:C, 1nd5:D, 1nd6:A, 1nd6:C, 1nd6:D |
4 | 1rpt:A | 342 | 344 | 0.2766 | 0.2661 | 0.2645 | 6.80e-21 | |
5 | 4aro:A | 401 | 95 | 0.0790 | 0.0648 | 0.2737 | 0.025 | |
6 | 4arv:A | 409 | 96 | 0.0851 | 0.0685 | 0.2917 | 0.042 | 4arv:B |
7 | 1nt4:A | 391 | 151 | 0.1216 | 0.1023 | 0.2649 | 0.053 | 1nt4:B, 6rmr:A |
8 | 1sk8:A | 435 | 101 | 0.0729 | 0.0552 | 0.2376 | 0.53 | 1sk9:A |
9 | 3ntl:A | 388 | 124 | 0.0973 | 0.0825 | 0.2581 | 0.70 | 3ntl:B |
10 | 7w7h:A | 541 | 57 | 0.0578 | 0.0351 | 0.3333 | 1.2 | 7w7h:B |
11 | 4n5f:A | 378 | 48 | 0.0486 | 0.0423 | 0.3333 | 2.9 | 4n5f:B |
12 | 3k4q:A | 438 | 117 | 0.0729 | 0.0548 | 0.2051 | 4.4 | 3k4q:B |
13 | 4fdt:A | 398 | 96 | 0.0699 | 0.0578 | 0.2396 | 4.7 | 4fdt:B, 4fdu:A, 4fdu:B |
14 | 8wrk:A | 434 | 124 | 0.1064 | 0.0806 | 0.2823 | 7.6 | 8in7:A, 8ina:A, 8ind:A, 8inj:A, 8ino:A, 8inv:A, 8wrj:A |
15 | 8tl1:A | 336 | 46 | 0.0517 | 0.0506 | 0.3696 | 7.7 | 8tl8:A, 8tl8:B |
16 | 3b55:A | 408 | 137 | 0.0821 | 0.0662 | 0.1971 | 8.6 | |
17 | 2wss:V | 66 | 27 | 0.0334 | 0.1667 | 0.4074 | 9.4 |