SKGTRFERDLLVELWKAGFAAIRVAGSGVSPFPCPDIVAGNGRTYLAIEVKMRKELPLYLSADEVEQLVTFARGFGAEAY
VALKLPRKKWRFFPVQMLERTEKNFKIDESVYPLGLEIAEVAGKF
The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2wiw:B | 126 | 123 | 0.9840 | 0.9762 | 1.0000 | 4.67e-87 | 2wiz:A, 2wj0:B, 2wj0:A |
2 | 3pzr:A | 370 | 61 | 0.1600 | 0.0541 | 0.3279 | 0.21 | 1mb4:A, 1mb4:B, 3pzr:B, 3q0e:A, 3q0e:B, 4r5m:A, 4r5m:B |
3 | 1qha:A | 903 | 78 | 0.1920 | 0.0266 | 0.3077 | 0.35 | 1bg3:A, 1bg3:B, 1cza:N, 1dgk:N, 4f9o:A, 4f9o:B, 4foe:A, 4foe:B, 4foi:A, 4foi:B, 4fpa:A, 4fpa:B, 4fpb:A, 4fpb:B, 1hkb:A, 1hkb:B, 1hkc:A, 1qha:B |
4 | 5xyi:E | 246 | 65 | 0.1440 | 0.0732 | 0.2769 | 0.59 | |
5 | 7os0:A | 1130 | 41 | 0.1280 | 0.0142 | 0.3902 | 0.89 | 7os0:C |
6 | 7ui7:A | 613 | 46 | 0.1200 | 0.0245 | 0.3261 | 3.2 | 7ui6:A, 7ui6:B |
7 | 7zvj:B | 587 | 46 | 0.1200 | 0.0256 | 0.3261 | 3.4 | 7zvj:A |
8 | 2w3j:A | 137 | 19 | 0.0720 | 0.0657 | 0.4737 | 3.5 | |
9 | 4efz:A | 295 | 45 | 0.1040 | 0.0441 | 0.2889 | 4.7 | 4efz:B |
10 | 4mob:A | 319 | 48 | 0.1200 | 0.0470 | 0.3125 | 5.3 | |
11 | 3hpa:A | 428 | 85 | 0.2080 | 0.0607 | 0.3059 | 5.3 | 3hpa:B |
12 | 4moc:A | 273 | 48 | 0.1200 | 0.0549 | 0.3125 | 5.8 | 3b7k:A, 3b7k:B, 3b7k:C |
13 | 5a01:A | 681 | 44 | 0.1280 | 0.0235 | 0.3636 | 7.2 | 5a01:B, 5a01:C |