SISPETINVAGAQRMLSQKMAREALQLRLGAGDPKALAATIAQYERSAADLDAGNAERNVSRMGAPEIAAQRQKVAQIWG
RYRAMLDQVAQPASQVDLRGFSQYSTELLGELNNLVSLMSARAD
The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gcv:A | 126 | 124 | 1.0000 | 0.9841 | 1.0000 | 1.89e-86 | 6gcv:B, 6gcv:C |
2 | 7uyy:A | 496 | 70 | 0.1855 | 0.0464 | 0.3286 | 1.2 | 7uyy:B |
3 | 6hfw:A | 429 | 55 | 0.1129 | 0.0326 | 0.2545 | 1.9 | 4fdn:A, 4fdo:A, 4fdp:A, 4fdp:B, 4feh:A, 4ff6:A, 4ff6:B, 6g83:A, 6g83:B, 6hez:A, 6hez:B, 6hf0:A, 6hf0:B, 6hf3:A, 6hf3:B, 6hfv:A, 6hfv:B, 6hfw:B, 4kw5:A, 4kw5:B, 4ncr:A, 4ncr:B, 5oel:B, 5oep:A, 5oep:B, 5oeq:A, 5oeq:B, 4p8c:B, 4p8h:A, 4p8h:B, 4p8k:B, 4p8l:B, 4p8m:A, 4p8n:B, 4p8p:B, 4p8t:B, 4p8y:B, 4pfa:A, 4pfa:B, 4pfd:A |
4 | 7dlm:A | 280 | 41 | 0.1048 | 0.0464 | 0.3171 | 2.0 | 7dlm:B, 7dn1:A, 7vyq:A, 7vyq:B, 7vyq:F, 7vyq:G |
5 | 7dn1:B | 280 | 36 | 0.1048 | 0.0464 | 0.3611 | 3.9 | 7dll:A, 7dll:B, 7dmg:A, 7dmg:B |
6 | 6xn1:B | 333 | 62 | 0.1774 | 0.0661 | 0.3548 | 4.7 | 6xn1:A, 6xn2:B, 6xn2:A |
7 | 3ieu:A | 293 | 53 | 0.1210 | 0.0512 | 0.2830 | 6.6 | 3ieu:B |
8 | 1ubw:A | 348 | 19 | 0.0806 | 0.0287 | 0.5263 | 9.4 | 1ubx:A, 1uby:A |