BioLiP

>protein
SHMTPDIILQRTGIDVRAVEQGDDAWHKLRLGVITASEVHNVIAKPRSGKKWPDMKMSYFHTLLAEVCTGVAPEVNAKAL
AWGKQYENDARTLFEFTSGVNVTESPIIYRDESMRTACSPDGLCSDGNGLELACPFTSRDFMKFRLGGFEAIKSAYMAQV
QYSMWVTRKNAWYFANYDPRMKREGLHYVVIERDEKYMASFDEIVPEFIEKMDEALAEIGFVFGEQWR

The query sequence (length=228) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3sm4:C	229	228	1.0000	0.9956	1.0000	1.56e-175	3slp:A, 3slp:B, 3slp:C, 3sm4:A, 3sm4:B, 4wuz:A, 4wuz:B, 4wuz:C
2	3sz4:A	195	198	0.2500	0.2923	0.2879	1.06e-15	3syy:A, 3sz5:A
3	5yeu:A	381	96	0.1184	0.0709	0.2812	0.011	5yeu:B
4	3n2o:A	630	56	0.0746	0.0270	0.3036	0.31	3n2o:B, 3n2o:C, 3n2o:D
5	1dhr:A	236	59	0.0658	0.0636	0.2542	1.3	1dir:A, 1dir:B, 1dir:C, 1dir:D, 1hdr:A
6	6ahi:B	306	122	0.1184	0.0882	0.2213	1.5
7	2yk0:A	698	75	0.0921	0.0301	0.2800	2.4	2xu0:A
8	3ppu:A	314	72	0.0833	0.0605	0.2639	2.9
9	7tmm:B	464	39	0.0658	0.0323	0.3846	3.2	7tmo:B, 7tmp:B
10	6rxs:A	218	73	0.0877	0.0917	0.2740	6.7
11	6rxj:A	235	247	0.2281	0.2213	0.2105	8.5	6rxj:B, 6rxk:A, 6rxl:A, 6rxm:A, 6rxm:B, 6rxm:C, 6rxm:D, 6rxm:E, 6rxm:F, 6rxo:A, 6rxo:B, 6rxp:A, 6rxp:B, 6rxq:A, 6rxq:B, 6rxq:C, 6rxq:D, 6rxr:A, 6rxr:B, 6rxr:C, 6rxr:D, 1s5p:A
12	7p38:A	832	38	0.0614	0.0168	0.3684	9.1	8hw3:A, 8hw3:B, 8hwk:A, 8hwk:B, 7p38:B, 7p39:A, 7p39:B
13	4axn:A	316	54	0.0746	0.0538	0.3148	9.6	4axn:B

[Back]