SHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQILKTHNVLRNVR
The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5mw9:A | 66 | 61 | 1.0000 | 0.9242 | 1.0000 | 4.84e-39 | 5i7c:A, 5i7c:B, 5i7c:C, 5i7c:D, 5mvw:A, 5mvw:B, 5mw0:A, 5mw0:B, 5mw9:B, 5mw9:E, 5mw9:F, 5mwe:A, 5mwe:B |
2 | 8ovo:A | 503 | 43 | 0.2295 | 0.0278 | 0.3256 | 0.68 | 8ovo:B, 8ovp:A, 8ovp:B, 2vha:A, 2vha:B |
3 | 3cgb:A | 444 | 39 | 0.1967 | 0.0270 | 0.3077 | 2.7 | 3cgb:B, 3cgc:A, 3cgc:B, 3cgd:A, 3cgd:B, 3cge:A, 3cge:B |
4 | 6qfo:A | 1348 | 41 | 0.2131 | 0.0096 | 0.3171 | 3.7 | 8a19:A, 8a1a:A, 6qep:A, 6qev:B, 6qfk:A, 6sh9:B, 2zxq:A |
5 | 6ob5:D | 151 | 27 | 0.1803 | 0.0728 | 0.4074 | 4.8 | |
6 | 5ocu:K | 333 | 27 | 0.1639 | 0.0300 | 0.3704 | 4.9 | 5ogc:K |
7 | 7b4u:A | 129 | 28 | 0.1639 | 0.0775 | 0.3571 | 7.1 | 7b4u:C, 7b4v:C, 7b4v:A |
8 | 5csl:A | 2050 | 39 | 0.2295 | 0.0068 | 0.3590 | 8.5 | |
9 | 7aih:B | 435 | 36 | 0.1967 | 0.0276 | 0.3333 | 8.8 | 7am2:B, 7ane:B |
10 | 7b6w:AAA | 438 | 35 | 0.1967 | 0.0274 | 0.3429 | 9.2 | |
11 | 3x1l:A | 573 | 45 | 0.2459 | 0.0262 | 0.3333 | 9.4 | |
12 | 7dng:A | 161 | 28 | 0.1639 | 0.0621 | 0.3571 | 10.0 | 7dnf:A, 7dnf:C, 7dnf:D, 7dnf:F |