SGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARA
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2jwo:A | 82 | 74 | 0.9467 | 0.8659 | 0.9595 | 2.71e-51 | 8t4r:A, 2v83:A, 2v83:B, 2v83:C, 2v85:A, 2v85:B, 2v86:B, 2v86:A, 2v87:A, 2v87:B, 2v88:A, 2v88:B, 2v89:B, 2v89:A |
2 | 8sm5:I | 138 | 30 | 0.1333 | 0.0725 | 0.3333 | 2.0 | |
3 | 2wh6:A | 157 | 30 | 0.1333 | 0.0637 | 0.3333 | 2.2 | 7p33:B, 7p33:D, 7p33:A, 7p33:E, 7p9w:A, 8sm5:A, 8sm5:C, 8sm5:G, 8sm5:E, 2v6q:A, 2xpx:A |
4 | 7lbe:C | 299 | 29 | 0.1733 | 0.0435 | 0.4483 | 3.1 | 7lbf:C, 7lbg:C |
5 | 8fia:A | 1772 | 22 | 0.1333 | 0.0056 | 0.4545 | 4.5 | |
6 | 5chc:A | 895 | 30 | 0.1467 | 0.0123 | 0.3667 | 4.8 | 5ch7:A, 5ch7:C, 5ch7:E, 5chc:C, 5chc:E, 5e7o:A, 5e7o:C, 5e7o:E, 5e7o:G, 5e7o:I, 5e7o:K, 4ydd:A, 4ydd:C, 4ydd:E |
7 | 3oft:A | 396 | 24 | 0.0933 | 0.0177 | 0.2917 | 6.6 | 3oft:B, 3oft:C, 3ofu:A, 3ofu:B, 3ofu:C, 3ofu:D, 3ofu:E, 3ofu:F |
8 | 1smr:A | 331 | 37 | 0.1600 | 0.0363 | 0.3243 | 8.7 | 1smr:C, 1smr:E, 1smr:G |