BioLiP

>protein
SGSSKNCNCQGTRHPVFDIAPNCLHCGKVVCVIEGLNKGKCGHCHEQLISDKAEENPELLAAQERLDRLLYFQDTSAERT
KIIDNASDFDMNQEVGLWGSARERALALKKQQRN

The query sequence (length=114) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7zpq:CC	114	114	1.0000	1.0000	1.0000	2.43e-83	7zrs:CC, 7zuw:CC
2	8alz:A	258	38	0.1404	0.0620	0.4211	0.13	8yey:C, 8yey:A, 8yfi:A, 8yfj:A, 8yxw:A, 8yxw:C, 8yxx:A, 8yxx:C
3	1exw:A	279	52	0.1930	0.0789	0.4231	0.55
4	8bef:x	210	80	0.2018	0.1095	0.2875	2.1	8bpx:x, 8bq5:x, 8bq6:x
5	8b6f:AL	218	50	0.1491	0.0780	0.3400	2.1	8bqs:AL, 8gym:s8, 8gym:S8, 8gzu:s8, 8gzu:S8, 7tgh:S8
6	3j31:Q	220	19	0.0789	0.0409	0.4737	2.7
7	7b0n:I	191	64	0.1491	0.0890	0.2656	3.3	6gcs:I, 7o6y:I, 7o71:I, 6rfq:I, 6rfr:I, 6rfs:I, 6y79:I, 6yj4:I
8	6xiz:A	477	39	0.1316	0.0314	0.3846	3.6	6xiz:B, 6z0j:A, 6z0k:A
9	6gaw:BY	206	49	0.1667	0.0922	0.3878	4.5	5aj4:BY, 4ce4:Y, 6gb2:BY, 7nqh:BY, 7nql:BY, 7nsh:BY, 7nsi:BY, 7nsj:BY, 8oin:BC, 8oiq:BC, 7qh6:V, 4v19:Y, 6ydp:BY, 6ydw:BY
10	8by6:B	152	62	0.1140	0.0855	0.2097	4.6	7abg:A1, 6d0y:A, 1h2t:Z, 1h2u:X, 1h2u:Y, 1n52:B, 5oo6:B, 5oo6:E, 5oo6:H, 5oo6:K, 5oo6:N, 5oo6:Q, 5oo6:T, 5oo6:W, 5oob:D, 5oob:J, 5oob:B, 5oob:G, 8pmp:B, 8pnt:B, 8srr:B, 8suy:B
11	3w08:A	351	89	0.2018	0.0655	0.2584	5.1	3w08:B
12	8e73:S8	181	47	0.1316	0.0829	0.3191	9.4	7a23:D, 7a24:D, 7aqr:I, 7ar7:I, 7ar8:I, 7arb:I, 8bee:I, 8bpx:I, 8bq5:I, 8bq6:I, 6x89:S8

[Back]