SGGKKFILELIETVYEEILDLEANLRNGQQTDSTAMWEALHIDDSSYDVNPFISMLSFDKGIKIMPRIFNFLDKQQKLKI
LQKIFNELSHLQIIILSSYKTTPKPTLTQLKKVDLFQMIILKIIVSFLSNNSNFIEIMGLLLQLIRNNNVSFLTTSKIGL
NLITILISRAALIKQSTWNEIYDKLFTSLESKIQLIFPPREYNDHIMRLQNDKFMDEAYIWAFLASLAASGKLNHQRIII
DEVRDEIFATINEAETLQKKEKELSVLPQRSQELDTELKSIIYNKEKLYQDLNLFLNVMGLVYRDGEISELK
The query sequence (length=312) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5lmg:B | 321 | 324 | 0.9872 | 0.9595 | 0.9506 | 0.0 | 5lm5:A, 5lm5:B, 5lmf:B, 5lmf:A, 5lmg:A |
2 | 4gzk:A | 650 | 67 | 0.0641 | 0.0308 | 0.2985 | 5.1 | 4ieg:A, 4ieg:B, 4ieg:C, 4ieg:D |
3 | 5fv0:B | 458 | 114 | 0.0769 | 0.0524 | 0.2105 | 6.5 | |
4 | 4fjv:A | 231 | 57 | 0.0513 | 0.0693 | 0.2807 | 7.9 | 8cms:AAA, 4fjv:C, 5qio:A, 5qip:A, 5qiq:A, 5qir:A, 5qis:A, 5qit:A, 5qiu:A, 5qiv:A, 5qiw:A, 5qix:A, 5qiy:A, 5qiz:A |
5 | 8b9a:2 | 568 | 79 | 0.0769 | 0.0423 | 0.3038 | 10.0 | 8b9b:2, 8b9c:2 |