SGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISS
The query sequence (length=93) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
4jiv:C |
93 |
92 |
0.9355 |
0.9355 |
0.9457 |
5.09e-55 |
4jj2:A, 4ku0:A, 4ku0:C, 4osd:A, 4osd:B, 4osd:G, 4osd:J, 6p1z:A, 6p1z:E, 6p1z:F, 6p1z:G |
2 |
6p20:A |
110 |
83 |
0.8602 |
0.7273 |
0.9639 |
4.90e-50 |
|
3 |
6p2a:C |
146 |
93 |
0.8710 |
0.5548 |
0.8710 |
1.28e-47 |
6p2a:A, 6p2a:B, 6p2a:D, 6p2a:E, 6p2a:F |
4 |
8kea:D |
245 |
54 |
0.2043 |
0.0776 |
0.3519 |
0.036 |
8kea:F, 8kea:E |
5 |
8kea:D |
245 |
59 |
0.1828 |
0.0694 |
0.2881 |
0.30 |
8kea:F, 8kea:E |
6 |
5gug:A |
1721 |
58 |
0.1828 |
0.0099 |
0.2931 |
0.45 |
5gug:B, 1n4k:A, 3t8s:B, 3uj0:A, 3uj0:B, 5xa1:A, 5xa1:B |
7 |
6mu1:A |
2149 |
59 |
0.1828 |
0.0079 |
0.2881 |
0.61 |
6mu1:C, 6mu1:B, 6mu1:D |
8 |
7lhf:C |
2300 |
59 |
0.1828 |
0.0074 |
0.2881 |
0.61 |
7lhe:A, 7lhe:D, 7lhe:C, 7lhe:B, 7lhf:A, 7lhf:D, 7lhf:B |
9 |
8ear:A |
2389 |
59 |
0.1828 |
0.0071 |
0.2881 |
0.61 |
8eaq:A, 8eaq:B, 8eaq:C, 8eaq:D, 8ear:D, 8ear:B, 8ear:C |
10 |
7nvn:Z |
529 |
53 |
0.1935 |
0.0340 |
0.3396 |
0.99 |
8i1u:F, 8i1u:N, 8i9u:F, 8i9u:N, 7nvl:Z, 7nvl:z, 7nvm:Z, 7nvm:z, 7nvn:z, 8sfe:z, 8sfe:Z, 8sff:Z, 8sff:z, 8sg8:Z, 8sg8:z, 8sg9:Z, 8sg9:z, 8sgc:Z, 8sgc:z, 8sgl:Z, 8sgl:z, 8sgq:z, 8sgq:Z, 8sh9:Z, 8sh9:z, 8sha:Z, 8sha:z, 8shd:Z, 8shd:z, 8she:Z, 8she:z, 8shf:Z, 8shf:z, 8shg:Z, 8shg:z, 8shl:Z, 8shl:z, 8shn:Z, 8shn:z, 8sho:Z, 8sho:z, 8shp:Z, 8shp:z, 8shq:Z, 8shq:z, 8sht:Z, 8sht:z, 7trg:I, 7ttn:I, 7ttt:I, 7tub:I, 7wu7:F, 7wu7:N, 7wz3:Z, 7wz3:z, 7x0s:K, 7x0s:z, 7x0v:K, 7x0v:z, 7x3j:Z, 7x3j:z, 7x3u:Z, 7x3u:z |
11 |
8hki:Z |
255 |
53 |
0.1935 |
0.0706 |
0.3396 |
1.9 |
|
12 |
7nvo:Z |
323 |
53 |
0.1935 |
0.0557 |
0.3396 |
2.1 |
8hki:z, 7nvo:z |
13 |
4eyu:A |
456 |
43 |
0.1398 |
0.0285 |
0.3023 |
4.9 |
4ask:A, 4ask:B, 4eyu:B, 4ez4:A, 4ez4:B, 4ezh:A, 4ezh:B, 6f6d:A, 5fp3:A, 5fp3:B, 5oy3:A, 2xue:A, 2xue:B, 2xxz:A, 2xxz:B |
14 |
1bxw:A |
172 |
37 |
0.1075 |
0.0581 |
0.2703 |
6.4 |
9fzc:A, 9fzc:B |
15 |
6ful:A |
478 |
43 |
0.1398 |
0.0272 |
0.3023 |
7.1 |
5a1l:A, 5a1l:B, 3avr:A, 3avs:A, 6fuk:A, 5fxv:A, 5fxv:B, 5fxw:A, 5fxw:B, 5fxx:A, 5fxx:B, 5fxz:A, 5fxz:B, 5fy0:A, 5fy0:B, 5fy1:A, 5fy1:B, 5fy7:A, 5fy7:B, 5fym:A, 5fym:B, 6g8f:A, 4uf0:A, 4uf0:B, 3zli:A, 3zli:B, 3zpo:A, 3zpo:B |