SFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPLAKDSKGRFFIDRDGFLFRYILDYLRDRQVVLPDHFPEKGRLKR
EAEYFQLPDLVKLLTPD
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6ocp:B | 99 | 98 | 0.9897 | 0.9697 | 0.9796 | 6.09e-65 | 6m8r:A, 6m8r:F, 6ocp:C, 6ocp:D, 6ocp:E, 6ocp:F, 6ocp:G, 6ocp:H, 6ocp:K, 6ocp:L, 6ocp:M, 6ocp:N |
| 2 | 6sga:FS | 277 | 67 | 0.2680 | 0.0939 | 0.3881 | 4.33e-04 | 6sga:FQ, 6sga:FR, 6sga:FU, 6sgb:FQ, 6sgb:FR, 6sgb:FU |
| 3 | 7e8e:D | 459 | 72 | 0.2268 | 0.0479 | 0.3056 | 0.007 | 7e87:B, 7e87:A, 7e87:C, 7e87:D, 7e8e:B, 1nn7:A, 7ukg:A, 7ukg:B, 7ukg:C, 7ukg:D |
| 4 | 8quc:A | 395 | 72 | 0.2371 | 0.0582 | 0.3194 | 0.010 | 8f1c:A, 8f1c:B, 8f1c:C, 8f1c:D, 8f1d:A, 8f1d:B, 8f1d:C, 8f1d:D, 7phi:C, 7phi:B, 7phi:D, 8quc:B, 8quc:D, 8quc:C, 8qud:A, 8qud:B, 8qud:C, 8qud:D |
| 5 | 2i2r:L | 138 | 68 | 0.2268 | 0.1594 | 0.3235 | 0.011 | 2i2r:A, 2i2r:C, 2i2r:D, 2i2r:I, 2i2r:J, 2i2r:K, 2nz0:B, 2nz0:D, 1s1g:A, 1s1g:B |
| 6 | 2i2r:B | 124 | 68 | 0.2268 | 0.1774 | 0.3235 | 0.013 | |
| 7 | 7ukh:A | 203 | 72 | 0.2268 | 0.1084 | 0.3056 | 0.024 | 7ukh:B, 7ukh:C, 7ukh:D |
| 8 | 8osg:F | 258 | 88 | 0.2680 | 0.1008 | 0.2955 | 0.16 | |
| 9 | 1t3q:B | 786 | 41 | 0.1546 | 0.0191 | 0.3659 | 0.38 | 1t3q:E |
| 10 | 8iuf:C1 | 495 | 41 | 0.1649 | 0.0323 | 0.3902 | 0.81 | 8iuj:c1, 8iuj:C1 |
| 11 | 8g4c:B | 248 | 71 | 0.1959 | 0.0766 | 0.2676 | 0.87 | 8g4c:C, 8g4d:B, 8g4d:C, 7tch:B, 7tch:C |
| 12 | 5juy:B | 1234 | 73 | 0.2577 | 0.0203 | 0.3425 | 0.87 | 1cy5:A, 3j2t:A, 3j2t:B, 3j2t:C, 3j2t:D, 3j2t:E, 3j2t:F, 3j2t:G, 3jbt:A, 3jbt:C, 3jbt:E, 3jbt:G, 3jbt:I, 3jbt:K, 3jbt:M, 5juy:A, 5juy:C, 5juy:D, 5juy:E, 5juy:F, 5juy:G, 2p1h:A, 5wve:A, 5wve:C, 5wve:E, 5wve:G, 5wve:I, 5wve:K, 5wve:M, 1z6t:A, 1z6t:B, 1z6t:C, 1z6t:D |
| 13 | 2xy4:A | 267 | 49 | 0.1753 | 0.0637 | 0.3469 | 4.4 | 4bbp:A, 2ogw:A, 2ogw:B, 2osv:A, 2osv:B, 2prs:A, 2prs:B, 2ps0:A, 2ps0:B, 2ps9:A, 2ps9:B, 7rcj:A, 7rcj:B, 7rcj:C, 7rcj:D, 7rcj:E, 7rcj:F, 2xqv:A |
| 14 | 4ttb:A | 189 | 18 | 0.0825 | 0.0423 | 0.4444 | 8.0 | 4ttb:B |
| 15 | 5u4s:B | 237 | 32 | 0.1134 | 0.0464 | 0.3438 | 8.5 | 5u4s:A |
| 16 | 7nhk:0 | 495 | 45 | 0.1443 | 0.0283 | 0.3111 | 8.7 |
umich.edu