Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SELDAKLNKLGVDRIAISPYKQWTRGYMEPGNIGNGYVTGLKVDAGVRDKSDNNVLDGIVSYDRAETKNAYIGQINMTTA
S

The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 1ibw:C 81 81 1.0000 1.0000 1.0000 2.53e-55 1ibw:E, 1ibw:A
2 6iaq:D 339 35 0.1235 0.0295 0.2857 4.5 6iaq:A, 6iaq:B, 6iaq:C
3 5awp:A 596 23 0.1358 0.0185 0.4783 6.9 5awq:A
4 7cn8:A 1125 16 0.0988 0.0071 0.5000 7.2 7cn8:B, 7cn8:C, 7ek6:A, 7xu0:A, 7xu1:C, 7xu1:B, 7xu2:A, 7xu2:C, 7xu2:B, 7xu4:A, 7xu4:C, 7xu4:B
5 3mlp:A 337 31 0.1605 0.0386 0.4194 7.8 3lyr:A, 3mln:A, 3mln:B, 3mlo:A, 3mlo:B, 3mlp:B, 3mlp:E, 3mlp:F
6 5xdh:A 86 22 0.1235 0.1163 0.4545 8.8 5xdh:B, 5xdh:C, 5xdh:D
7 5wyj:CB 1098 65 0.2716 0.0200 0.3385 9.7 7ajt:UV, 7aju:UV, 7d4i:RE, 7d5s:RE, 7d5t:RE, 7d63:RE, 6ke6:RE, 6lqp:RE, 6lqq:RE, 6lqr:RE, 6lqs:RE, 6lqt:RE, 6lqu:RE, 7suk:NH, 5wyk:CB, 6zqb:UV, 6zqc:UV, 6zqd:UV, 6zqe:UV

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218