SEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDY
HVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPP
PPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGS
The query sequence (length=202) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4w79:A | 202 | 202 | 1.0000 | 1.0000 | 1.0000 | 5.58e-154 | 3c9q:A |
2 | 6uts:A | 229 | 81 | 0.0990 | 0.0873 | 0.2469 | 2.7 | |
3 | 4wh3:A | 356 | 27 | 0.0545 | 0.0309 | 0.4074 | 2.8 | 4ock:A, 4oco:A, 4ocp:A, 4ocv:A, 4wh2:A |
4 | 1dqn:A | 230 | 136 | 0.1584 | 0.1391 | 0.2353 | 2.8 | 1dqn:B, 1dqp:A, 1dqp:B |
5 | 8avk:A | 202 | 54 | 0.0792 | 0.0792 | 0.2963 | 4.1 | 8avk:B, 8avn:A, 8avn:B |
6 | 7a57:B | 449 | 72 | 0.0941 | 0.0423 | 0.2639 | 8.2 |