BioLiP

>protein
SDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKLYLYMKTPERAHTPAKLWERIK
LSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMITERRLALREEERHYVGVAPKVKRREQNRERKALVAAKIEKA
IEKELMDRLKSGAYGDKPLNVDEKVWKKIM

The query sequence (length=190) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6c0f:D	190	190	1.0000	1.0000	1.0000	8.36e-144	6cb1:D, 8e5t:D, 6em1:3, 6em3:3, 6em4:3, 6em5:3, 7ohs:3, 7ohw:3, 7ohx:3, 8v83:R, 8v84:R, 5z3g:Z
2	8eup:3	194	189	0.6474	0.6340	0.6508	1.04e-89	8esq:3, 8etc:3, 8etg:3, 8eth:3, 8eti:3, 8etj:3, 8eug:3, 8eui:3, 8euy:3, 8ev3:3
3	8i9p:Ce	194	194	0.6158	0.6031	0.6031	2.26e-85	8i9r:Ce, 8i9t:Ce, 8i9v:Ce
4	8fkp:NM	182	177	0.5368	0.5604	0.5763	6.55e-65	8fkr:NM, 8fkt:NM, 8fkv:NM
5	2xt3:A	300	91	0.1368	0.0867	0.2857	1.1	4a14:A
6	4c5i:A	423	110	0.1211	0.0544	0.2091	6.3
7	6yxx:EN	638	95	0.1211	0.0361	0.2421	8.0	6yxy:EN
8	8h1c:B	983	39	0.0842	0.0163	0.4103	10.0	8h1c:A, 7xjz:A, 7xk0:A, 7xk1:A, 7xk1:C
9	3uej:A	65	76	0.0842	0.2462	0.2105	10.0	7knd:A, 7knj:A, 7ko6:A, 7l92:A, 7l92:D, 7l92:G, 7l92:J, 7l92:M, 7l92:V, 7l92:P, 7l92:S, 7lcb:A, 7leo:A, 7leo:D, 7lf3:A, 1ptq:A, 1ptr:A, 3uej:B, 3uey:A, 3uey:B, 3uff:A, 3uff:B, 3ugd:A, 3ugd:B, 3ugi:A, 3ugi:B, 3ugl:A, 3ugl:B

[Back]