SCYIYWDKIKRIASRLEGMNYHFDEMDTSGVMPLLDEIEEIAHDSTIDFESAKHILDDAEMNHALSLIRKFYVNLGMKLQ
MEKAQEVIESDSPWETLRSFYFYPRYLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAEL
SRKVIEGLGVDGVNVITGDETVIDGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIYRTYTGMRAILYAPVSDDDITG
FRRAGVVLPSGKVNNTSVLVFKCP
The query sequence (length=264) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3fpj:B | 265 | 264 | 1.0000 | 0.9962 | 1.0000 | 0.0 | 3fpe:A, 3fpe:B, 3fpf:A, 3fpf:B, 3fph:A, 3fph:B, 3fpj:A, 3o31:A, 3o31:B |
2 | 3gwz:A | 339 | 117 | 0.1364 | 0.1062 | 0.3077 | 0.020 | 3gwz:D, 3gwz:C, 3gwz:B, 3gxo:A, 3gxo:D, 3gxo:C, 3gxo:B |
3 | 1jg1:A | 215 | 158 | 0.1477 | 0.1814 | 0.2468 | 0.38 | 1jg2:A, 1jg3:A, 1jg3:B, 1jg4:A |
4 | 6gua:A | 821 | 59 | 0.0606 | 0.0195 | 0.2712 | 1.0 | 6gua:B, 6gua:C, 6gua:D, 6gua:E, 6gua:F, 6gua:G, 6gua:H |
5 | 1dl5:A | 317 | 61 | 0.0758 | 0.0631 | 0.3279 | 1.2 | 1dl5:B |
6 | 7c9k:B | 233 | 48 | 0.0455 | 0.0515 | 0.2500 | 1.3 | 7c9k:A |
7 | 1vtm:P | 158 | 109 | 0.1023 | 0.1709 | 0.2477 | 1.3 | |
8 | 7swl:E | 480 | 91 | 0.0871 | 0.0479 | 0.2527 | 1.3 | |
9 | 7c9m:C | 260 | 48 | 0.0455 | 0.0462 | 0.2500 | 1.4 | 7c7m:A, 7c9m:A, 7c9m:B, 7c9m:D |
10 | 6mat:A | 578 | 91 | 0.0871 | 0.0398 | 0.2527 | 1.9 | 6mat:C, 6mat:E, 6mat:B, 6mat:D, 6mat:F, 7swl:A, 7swl:B, 7swl:C, 7swl:D, 7t0v:A, 7t0v:B, 7t0v:C, 7t0v:D, 7t0v:E, 7t0v:F, 7t3i:A, 7t3i:B, 7t3i:C, 7t3i:E, 7t3i:D |
11 | 6ywe:8 | 331 | 92 | 0.0947 | 0.0755 | 0.2717 | 2.0 | 6yws:8, 6ywv:8, 6ywx:8, 6ywy:8 |
12 | 5e72:A | 323 | 84 | 0.0909 | 0.0743 | 0.2857 | 2.4 | |
13 | 6am0:A | 260 | 98 | 0.0985 | 0.1000 | 0.2653 | 3.0 | 6am0:E, 5lop:A |
14 | 4q4a:A | 572 | 75 | 0.0682 | 0.0315 | 0.2400 | 7.7 | 3qf4:A, 6quz:A, 6quz:C, 6qv0:A, 6qv0:C, 6qv1:A, 6qv1:C, 6qv2:A, 6qv2:C |
15 | 5jbx:B | 261 | 65 | 0.0606 | 0.0613 | 0.2462 | 8.6 | 5jbx:A |
16 | 6i3d:B | 218 | 35 | 0.0455 | 0.0550 | 0.3429 | 8.8 | 3a7e:A, 3bwm:A, 3bwy:A, 6i3c:A, 6i3d:A, 5lsa:A, 4pyj:A, 4pyk:A, 4xuc:A, 4xud:A, 4xue:B, 4xue:A |
17 | 4mix:B | 277 | 70 | 0.0644 | 0.0614 | 0.2429 | 8.8 | 4mix:A |
18 | 3ll3:A | 492 | 73 | 0.0720 | 0.0386 | 0.2603 | 9.3 | 3ll3:B |