SAVRSRAEAVKVSRTFDYMILFTVFFVVLGGYHIHYMLTGGDWDFWTDWKDRRLWVTVAPIVSITFPAAVQAVLWWRYRI
AWGATLCVLGLLLGEWINRYFNFWGWTYFPVNFVFPSNLMPGAIVLDVILMLSNSMTLTAVVGGLAWGLLFYPGNWPIIA
PLHVPVEYNGMMMTLADLQGYHYVRTGTPEYIRMVEKGTLRTFGKDVAPVSAFFSGFVSILIYFLWHFFGSWFGSEKFV
The query sequence (length=239) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6cxh:B | 241 | 239 | 1.0000 | 0.9917 | 1.0000 | 5.54e-176 | 7s4l:B, 7s4l:G, 7s4l:F |
2 | 7t4p:B | 241 | 238 | 0.7824 | 0.7759 | 0.7857 | 1.11e-143 | 7t4p:F, 7t4p:J |
3 | 7s4m:F | 244 | 236 | 0.6276 | 0.6148 | 0.6356 | 5.91e-104 | 7s4m:B, 7s4m:J |
4 | 3chx:B | 238 | 236 | 0.6109 | 0.6134 | 0.6186 | 1.31e-102 | 3chx:F, 3chx:J |
5 | 2g80:A | 225 | 38 | 0.0628 | 0.0667 | 0.3947 | 0.29 | 2g80:B, 2g80:C, 2g80:D |
6 | 6ohr:A | 576 | 70 | 0.0669 | 0.0278 | 0.2286 | 1.3 | 6ohr:B, 6ohr:C, 6ohr:D, 6ohr:E, 6u8z:A |
7 | 7d7c:F | 137 | 41 | 0.0502 | 0.0876 | 0.2927 | 4.4 | 7d7d:F |