SAVKKQRIDLRLTDDDKSMIEEAAAISNQSVSQFMLNSASQRAAEVIEQHRRVILNEESWTRVMDALSNPP
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gts:C | 83 | 68 | 0.9577 | 0.8193 | 1.0000 | 4.17e-45 | 6gts:B |
2 | 5zgn:B | 82 | 68 | 0.7183 | 0.6220 | 0.7500 | 1.28e-34 | 5zgn:A, 5zgn:D, 5zgn:E |
3 | 1eyx:B | 177 | 27 | 0.1831 | 0.0734 | 0.4815 | 0.51 | 1eyx:L, 1lia:B, 1lia:L |
4 | 7cnp:A | 559 | 38 | 0.1690 | 0.0215 | 0.3158 | 0.69 | 7cnp:B, 7cnp:C, 7cnq:A, 7cnq:B, 7cnq:C, 7cnq:D, 7d2r:A |
5 | 7br7:x | 1325 | 39 | 0.1549 | 0.0083 | 0.2821 | 2.3 | 7bqx:x |