SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFL
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ilp:A | 71 | 65 | 0.9848 | 0.9155 | 1.0000 | 2.89e-44 | 1ilq:A, 6xmn:A |
2 | 4r9w:B | 64 | 63 | 0.3636 | 0.3750 | 0.3810 | 4.81e-13 | |
3 | 2nwg:A | 68 | 46 | 0.2576 | 0.2500 | 0.3696 | 8.47e-05 | 2nwg:B, 4uai:A |
4 | 2ra4:B | 65 | 30 | 0.1818 | 0.1846 | 0.4000 | 0.002 | |
5 | 7f1t:A | 423 | 54 | 0.2424 | 0.0378 | 0.2963 | 0.002 | 6akx:A, 6akx:B, 6aky:A, 5d65:B, 5d65:A, 5d65:D, 4mbs:A, 4mbs:B, 5uiw:A |
6 | 2hci:A | 68 | 55 | 0.2273 | 0.2206 | 0.2727 | 0.007 | |
7 | 2mpm:A | 74 | 38 | 0.2121 | 0.1892 | 0.3684 | 0.007 | |
8 | 4r8i:A | 68 | 34 | 0.1667 | 0.1618 | 0.3235 | 0.052 | |
9 | 6fgp:B | 68 | 57 | 0.2121 | 0.2059 | 0.2456 | 0.13 | 1b3a:B, 1b3a:A, 5coy:A, 5dnf:C, 5dnf:D, 5dnf:I, 5dnf:A, 5dnf:F, 5dnf:G, 5dnf:H, 1u4l:A, 1u4m:A |
10 | 8tzc:A | 872 | 25 | 0.1515 | 0.0115 | 0.4000 | 0.73 | |
11 | 8txz:A | 858 | 48 | 0.2273 | 0.0175 | 0.3125 | 1.5 | |
12 | 8u8b:A | 1712 | 48 | 0.2273 | 0.0088 | 0.3125 | 1.6 | 8u7l:B, 8u7l:A, 8u8a:B, 8u8a:C, 8u8b:B, 2zej:A |
13 | 8u7h:C | 1111 | 48 | 0.2273 | 0.0135 | 0.3125 | 1.7 | |
14 | 8tzg:A | 906 | 48 | 0.2273 | 0.0166 | 0.3125 | 1.7 | |
15 | 8tzf:A | 1589 | 48 | 0.2273 | 0.0094 | 0.3125 | 1.7 | |
16 | 8tyq:A | 957 | 48 | 0.2273 | 0.0157 | 0.3125 | 1.7 | 8tze:A |
17 | 6vno:A | 1084 | 48 | 0.2273 | 0.0138 | 0.3125 | 1.7 | 6vp6:A |
18 | 8smc:C | 1084 | 48 | 0.2273 | 0.0138 | 0.3125 | 1.8 | |
19 | 8tzb:A | 920 | 48 | 0.2273 | 0.0163 | 0.3125 | 1.8 | |
20 | 8fo9:A | 1173 | 48 | 0.2273 | 0.0128 | 0.3125 | 1.8 | 8fo9:C |
21 | 8fo9:F | 2289 | 48 | 0.2273 | 0.0066 | 0.3125 | 1.9 | 9c61:A, 9c61:B, 8fo2:E, 8fo7:C, 8fo8:C, 8fo8:E, 8fo9:E, 7lht:A, 7lht:B, 7lhw:A, 7li3:A, 7li4:A, 6oje:A, 6oje:B, 6ojf:A, 6ojf:B, 7thy:A, 7thz:A, 6xaf:A, 6xaf:B, 2zej:B |
22 | 2xz7:A | 324 | 24 | 0.1061 | 0.0216 | 0.2917 | 3.0 | 2xz9:A, 2xz9:B |
23 | 3c6g:B | 467 | 35 | 0.1970 | 0.0278 | 0.3714 | 5.9 | 3c6g:A, 3czh:A, 3czh:B, 3dl9:A, 3dl9:B |
24 | 6yws:h | 98 | 26 | 0.1364 | 0.0918 | 0.3462 | 7.8 | |
25 | 5g26:A | 241 | 25 | 0.1212 | 0.0332 | 0.3200 | 8.3 |