BioLiP

>protein
SAKAPVITIFDHRGCSRAPKEYSKASGQDDEMMVKAQSVKIAVSDGVAESVLKDSLSVMH

The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7tja:G	67	62	1.0000	0.8955	0.9677	8.42e-37	7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O
2	1qgw:B	67	61	0.8000	0.7164	0.7869	4.41e-28	1xf6:B, 1xg0:B
3	1qgw:A	76	60	0.6167	0.4868	0.6167	4.76e-19	1xf6:A, 1xg0:A
4	7tja:I	75	55	0.6167	0.4933	0.6727	5.90e-19	7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M
5	7t8s:D	70	64	0.6167	0.5286	0.5781	1.41e-18	7t8s:H, 7t8s:L, 7t8s:P
6	7t8s:B	78	60	0.5833	0.4487	0.5833	1.31e-13	7t8s:F, 7t8s:J, 7t8s:N
7	7sut:C	63	60	0.5000	0.4762	0.5000	1.54e-11	7sut:G
8	4lms:C	68	61	0.4667	0.4118	0.4590	5.14e-10
9	7t7u:C	70	60	0.4833	0.4143	0.4833	1.47e-09
10	7t7u:A	81	58	0.4000	0.2963	0.4138	1.70e-08
11	4lms:A	80	56	0.3167	0.2375	0.3393	3.00e-05
12	7ssf:A	72	51	0.3000	0.2500	0.3529	0.001	7ssf:C, 7ssf:E, 7ssf:G
13	7sut:A	78	47	0.2667	0.2051	0.3404	0.006	7sut:E
14	4lmx:E	66	54	0.3667	0.3333	0.4074	0.043	8el3:C, 8el3:I, 8el3:E, 8el3:L, 8el4:C, 8el4:E, 8el5:C, 8el5:I, 8el5:E, 8el5:L, 8el6:C, 8el6:E, 4lmx:A, 4lmx:G, 4lmx:I, 4lmx:K
15	7s96:A	63	51	0.2833	0.2698	0.3333	0.060	7s96:C, 7s97:C, 7t89:A, 7t89:C
16	4lm6:A	62	50	0.2500	0.2419	0.3000	0.26	4lm6:C
17	5hh7:A	192	23	0.1833	0.0573	0.4783	2.3
18	6hzf:A	860	40	0.2500	0.0174	0.3750	3.7	6hze:A, 6hze:B, 6hzf:B, 6hzg:A
19	8tdf:A	452	40	0.1833	0.0243	0.2750	6.9	8tdf:B, 8tdf:C, 8tdf:D, 8tdh:B, 8tdh:C, 8tdh:D, 8tdh:A
20	7aor:ab	1110	50	0.2500	0.0135	0.3000	7.0
21	5awp:A	596	35	0.1833	0.0185	0.3143	9.8	5awq:A

[Back]