RVVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRIGTRYGGSSSNPGLPDMRGLFVRGSGRGSHL
TNPNVNGNDQFGKPRLGVGCTGGYVGEVQKQQMSYHKHAGGFGEYDDSGAFGNTRRSNFVGTRKGLDWDNRSYFTNDGYE
IDPASQRNSRYTLNRPELIGNETRPWNISLNYIIKVKE
The query sequence (length=198) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5iv5:O | 526 | 198 | 0.9596 | 0.3612 | 0.9596 | 2.62e-144 | 5iv5:P, 5iv5:Q, 5iv5:l, 5iv5:m, 5iv5:n, 5iv5:AI, 5iv5:AJ, 5iv5:BA, 5iv5:DB, 5iv5:DC, 5iv5:DD, 5iv5:FE, 5iv5:FF, 5iv5:FG, 5iv5:HH, 5iv5:HI, 5iv5:HJ, 1ocy:A |
2 | 1dpp:A | 507 | 96 | 0.1414 | 0.0552 | 0.2917 | 0.93 | 1dpp:C, 1dpp:E, 1dpp:G |
3 | 2xgf:A | 216 | 66 | 0.1061 | 0.0972 | 0.3182 | 2.1 | 2xgf:B, 2xgf:C |
4 | 4k6n:A | 352 | 36 | 0.0606 | 0.0341 | 0.3333 | 2.7 | |
5 | 3tto:A | 1055 | 75 | 0.1162 | 0.0218 | 0.3067 | 9.0 | 3tto:B, 3tto:C, 3tto:D, 3ttq:A, 4ttu:A, 4tvc:A, 4tvd:A |
6 | 6ifd:B | 234 | 44 | 0.0556 | 0.0470 | 0.2500 | 9.5 | 6ifd:A, 6ifd:C |
7 | 2ex8:A | 456 | 39 | 0.0758 | 0.0329 | 0.3846 | 9.8 | 2ex6:A, 2ex9:A, 2exa:A, 2exb:A |