RVSTRSSLAEDLRAIGLADGDAVLVHAALRKVGKIVGGPDDILDAMRDVIGPAGTVLGYADWQLEDEIRDDPAMREHIPA
FDPLRSRSIRDNGFWPELIRTTPGALRSASPGASMAAIGGEAEWFTADHALDYGYGPRSPLGKLVEAKGKVLMLGAPLDT
MTLLHHAEHLADFPNKRILRYEAPILVDGEKVWRWFEEFDTSDPPDGLADDYFAGIVEEFLATGRGKRGKIGEASSVLVP
ADEIVAFAVDWLERWGRTA
The query sequence (length=259) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ht0:C | 261 | 259 | 1.0000 | 0.9923 | 1.0000 | 0.0 | 5ht0:A, 5ht0:B, 5ht0:D, 5ht0:E, 5ht0:F, 7kes:A, 7kes:B, 6mn0:A, 6mn0:B, 6mn0:C, 6mn0:F, 6mn0:D, 6mn0:E, 6mn1:A, 6mn1:B, 6mn2:A, 6mn2:B |
2 | 6mb6:A | 268 | 259 | 0.6332 | 0.6119 | 0.6332 | 3.36e-103 | 6mb4:B, 6mb5:A, 6mb6:C, 6mb7:A, 6mb9:A, 6mb9:B, 6mb9:D, 6mb9:C |
3 | 7q1d:D | 272 | 263 | 0.4788 | 0.4559 | 0.4715 | 1.28e-76 | 7mqk:A, 7mqk:B, 7mqk:C, 7mqk:D, 7mql:A, 7mql:B, 7mql:C, 7mql:D, 7mqm:A, 7mqm:B, 7mqm:C, 7mqm:D, 7q0q:A, 7q0q:B, 7q10:A, 7q1d:A, 7q1d:B, 7q1d:C, 7q1x:A |
4 | 6bc2:A | 268 | 264 | 0.3784 | 0.3657 | 0.3712 | 2.50e-52 | 6bbz:A, 6bc3:A, 6bc4:A, 6bc5:A, 6bc7:A, 6np2:A, 6np3:A, 6np4:A, 6np5:A, 6nti:A, 6ntj:A, 6o5u:A |
5 | 2nyg:A | 270 | 259 | 0.3359 | 0.3222 | 0.3359 | 9.49e-39 | 2nyg:B, 2nyg:C, 2nyg:D, 2nyg:E |
6 | 3sma:B | 268 | 260 | 0.3398 | 0.3284 | 0.3385 | 1.30e-31 | 3sma:A, 3sma:C, 3sma:D |
7 | 3kzl:A | 266 | 266 | 0.3089 | 0.3008 | 0.3008 | 5.17e-30 | 3ijw:A, 3ijw:B, 3kzl:D, 3kzl:C, 3kzl:B, 3n0m:A, 3n0m:B, 3n0s:A, 3n0s:D, 3n0s:C, 3n0s:B, 3slb:A, 3slb:D, 3slb:C, 3slb:B, 3slf:A, 3slf:B |
8 | 6mn5:D | 260 | 250 | 0.2973 | 0.2962 | 0.3080 | 4.12e-17 | 6mn3:A, 6mn3:B, 6mn4:A, 6mn4:B, 6mn4:C, 6mn4:D, 6mn4:E, 6mn4:F, 6mn5:A, 6mn5:B, 6mn5:C, 6mn5:E, 6mn5:F |
9 | 4fgo:A | 181 | 46 | 0.0656 | 0.0939 | 0.3696 | 1.0 | |
10 | 7kcl:B | 614 | 86 | 0.0965 | 0.0407 | 0.2907 | 4.7 | 7c04:A, 7c7b:A, 5f5r:A, 5f5r:B, 5hph:A, 5hph:B, 7kck:A, 7kck:B, 7kcl:A, 7kcm:A, 7kcm:B, 7klu:A, 7klu:B, 7klu:D, 7klu:C, 7klv:A, 7klv:B, 6xg6:A, 6xg6:B, 4z1i:A, 4z1i:B, 4z1i:C, 4z1i:D |
11 | 2xnj:A | 255 | 58 | 0.0695 | 0.0706 | 0.3103 | 5.5 | 1fdr:A, 2xnj:B |
12 | 6io1:B | 448 | 30 | 0.0579 | 0.0335 | 0.5000 | 6.7 | 6io1:A |
13 | 6bge:A | 323 | 34 | 0.0579 | 0.0464 | 0.4412 | 7.7 | 6bge:B, 1g6o:A, 1g6o:B, 1nly:A, 1nly:B |
14 | 5z79:C | 599 | 48 | 0.0579 | 0.0250 | 0.3125 | 7.9 | 5z79:A, 5z79:D, 5z79:E, 5z79:F |
15 | 5vn4:A | 237 | 42 | 0.0502 | 0.0549 | 0.3095 | 8.4 | 5vn4:B |
16 | 5z79:B | 562 | 48 | 0.0579 | 0.0267 | 0.3125 | 8.7 | |
17 | 3zqx:A | 146 | 65 | 0.0811 | 0.1438 | 0.3231 | 8.9 | |
18 | 5tth:B | 621 | 55 | 0.0734 | 0.0306 | 0.3455 | 9.2 | 6d14:B, 7exp:B, 4ipe:B, 4iyn:B, 4j0b:B, 5tvu:B, 5tvw:B, 5tvx:B |